Pfam domain
Pfam family: RVT_1 (PF00078.29)
Uniprot AC: P03366
RecName: Gag-Pol polyprotein
Begin-End: 662-810
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate BH10)
Interaction Mode:   

Sequence:
IKKKDSTKWRKLVDFRELNKRTQDFWEVQLGIPHPAGLKKKKSVTVLDVGDAYFSVPLDE
DFRKYTAFTIPSINNETPGIRYQYNVLPQGWKGSPAIFQSSMTKILEPFKKQNPDIVIYQ
YMDDLYVGSDLEIGQHRTKIEELRQHLLR
Structures of the domain P03366 662-810
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1hvu X-ray 4.75 K 63-239 None
1hvu X-ray 4.75 H 63-239 None
1hvu X-ray 4.75 E 63-239 None
1hvu X-ray 4.75 B 63-239 None


© NPIDB team 2003 - 2021

text