Pfam domain
Pfam family: DNA_pol_B_2 (PF03175.15)
Uniprot AC: P03680
RecName: DNA polymerase
Begin-End: 49-477
Organism: Bacillus phage phi29
Interaction Mode:  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 

Sequence:
AWVLKVQADLYFHNLKFDGAFIINWLERNGFKWSADGLPNTYNTIISRMGQWYMIDICLG
YKGKRKIHTVIYDSLKKLPFPVKKIAKDFKLTVLKGDIDYHKERPVGYKITPEEYAYIKN
DIQIIAEALLIQFKQGLDRMTAGSDSLKGFKDIITTKKFKKVFPTLSLGLDKEVRYAYRG
GFTWLNDRFKEKEIGEGMVFDVNSLYPAQMYSRLLPYGEPIVFEGKYVWDEDYPLHIQHI
RCEFELKEGYIPTIQIKRSRFYKGNEYLKSSGGEIADLWLSNVDLELMKEHYDLYNVEYI
SGLKFKATTGLFKDFIDKWTYIKTTSEGAIKQLAKLMLNSLYGKFASNPDVTGKVPYLKE
NGALGFRLGEEETKDPVYTPMGVFITAWARYTTITAAQACYDRIIYCDTDSIHLTGTEIP
DVIKDIVDP
Structures of the domain P03680 49-477
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1xhz X-ray 2.7 D 49-477 None
1xhz X-ray 2.7 C 49-477 None
1xhz X-ray 2.7 B 49-477 None
1xhz X-ray 2.7 A 49-477 None
2py5 X-ray 1.6 A 49-477 None
2py5 X-ray 1.6 B 49-477 None
2pzs X-ray 2.6 A 49-477  H-Bb L-Bb L-Mj L-Mn 
2pzs X-ray 2.6 C 49-477 None
2pzs X-ray 2.6 B 49-477 None
2pzs X-ray 2.6 D 49-477  S-Bb L-Bb L-Mj 
2pyl X-ray 2.2 A 49-477  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
1xi1 X-ray 2.2 A 49-477 None
1xi1 X-ray 2.2 B 49-477 None
2pyj X-ray 2.03 A 49-477  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 
2pyj X-ray 2.03 B 49-477  H-Bb H-Mn S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text