Pfam domain
Pfam family: Exc (PF07825.13)
Uniprot AC: P03699
RecName: Excisionase
Begin-End: 1-55
Organism: Escherichia phage lambda
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
MYLTLQEWNARQRRPRSLETVRRWVRECRIFPPPVKDGREYLFHESAVKVDLNRP
Structures of the domain P03699 1-55
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ief X-ray 2.6 A 1-55  H-Bb H-Mj S-Bb L-Bb 
2ief X-ray 2.6 C 1-53  H-Bb H-Mj S-Bb L-Bb L-Mn 
2ief X-ray 2.6 B 1-54  H-Bb H-Mj S-Bb L-Bb L-Mn 
1rh6 X-ray 1.7 A 1-55 None
1rh6 X-ray 1.7 B 1-52  H-Bb H-Mj S-Bb L-Bb L-Mn 
5j0n X-ray 11 M 1-53 None
5j0n X-ray 11 N 1-54 None
5j0n X-ray 11 O 1-55 None
6p0t X-ray 3.6 E 1-52  H-Bb H-Mj L-Bb 
2og0 X-ray 1.9 B 1-52  H-Bb H-Mj S-Bb L-Bb L-Mn 
2og0 X-ray 1.9 A 1-51  H-Bb H-Mj L-Bb 
6p0s X-ray 2.7 E 1-52  H-Bb H-Mj S-Bb L-Bb L-Mn 
6p0u X-ray 3.3 F 1-51  H-Bb H-Mj S-Bb L-Bb 
6p0u X-ray 3.3 E 1-52  H-Bb H-Mj S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text