Pfam domain
Pfam family: Rep_3 (PF01051.23)
Uniprot AC: P03856
RecName: Replication initiation protein
Begin-End: 15-242
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 

Sequence:
SPRIVQSNDLTEAAYSLSRDQKRMLYLFVDQIRKSDGTLQEHDGICEIHVAKYAEIFGLT
SAEASKDIRQALKSFAGKEVVFYRPEEDAGDEKGYESFPWFIKRAHSPSRGLYSVHINPY
LIPFFIGLQNRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSLKIDWIIERYQL
PQSYQRMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGRQTTHIVFSF
Structures of the domain P03856 15-242
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1rep X-ray 2.6 C 15-242  H-Bb H-Mj S-Bb L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text