Pfam domain
Pfam family: Rep_3 (PF01051.23)
Uniprot AC: P03856
RecName: Replication initiation protein
Begin-End: 20-242
Organism: Escherichia coli
Interaction Mode:   

Sequence:
QSNDLTEAAYSLSRDQKRMLYLFVDQIRKSDGTLQEHDGICEIHVAKYAEIFGLTSAEAS
KDIRQALKSFAGKEVVFYRPEEDAGDEKGYESFPWFIKRAHSPSRGLYSVHINPYLIPFF
IGLQNRFTQFRLSETKEITNPYAMRLYESLCQYRKPDGSGIVSLKIDWIIERYQLPQSYQ
RMPDFRRRFLQVCVNEINSRTPMRLSYIEKKKGRQTTHIVFSF
Structures of the domain P03856 20-242
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2z9o X-ray 3.14 B 20-242  H-Bb H-Mj L-Bb L-Mj 
2z9o X-ray 3.14 A 21-242  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text