Pfam domain
Pfam family: Peptidase_A6 (PF01829.18)
Uniprot AC: P04329
RecName: Capsid protein alpha
Begin-End: 56-363
Organism: Black beetle virus
Interaction Mode:   

Sequence:
LTRLSQPGLAFLKCAFAPPDFNTDPGKGIPDRFEGKVVTRKDVLNQSINFTANRDTFILI
APTPGVAYWVADVPAGTFPISTTTFNAVNFPGFNSMFGNAAASRSDQVSSFRYASMNVGI
YPTSNLMQFAGSITVWKCPVKLSNVQFPVATTPATSALVHTLVGLDGVLAVGPDNFSESF
IKGVFSQSVCNEPDFEFSDILEGIQTLPPANVTVATSGQPFNLAAGAEAVSGIVGWGNMD
TIVIRVSAPTGAVNSAILKTWACLEYRPNPNAMLYQFGHDSPPCDEVALQEYRTVARSLP
VAVIAAQN
Structures of the domain P04329 56-363
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2bbv X-ray 2.8 A 56-363 None
2bbv X-ray 2.8 C 28-363 None
2bbv X-ray 2.8 B 56-363 None


© NPIDB team 2003 - 2021

text