Pfam domain
Pfam family: Zn_clus (PF00172.20)
Uniprot AC: P04386
RecName: Regulatory protein GAL4
Begin-End: 9-47
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
QACDICRLKKLKCSKEKPKCAKCLKNNWECRYSPKTKRS
Structures of the domain P04386 9-47
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1d66 X-ray 2.7 B 9-47  H-Mj L-Bb L-Mj 
1d66 X-ray 2.7 A 9-47  H-Bb H-Mj L-Bb L-Mj 
3coq X-ray 2.4 A 9-47  H-Bb H-Mj L-Bb L-Mj 
3coq X-ray 2.4 B 9-47  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text