Pfam domain
Pfam family: Pyr_excise (PF03013.16)
Uniprot AC: P04418
RecName: Endonuclease V
Begin-End: 2-91
Organism: Enterobacteria phage T4
Interaction Mode:  H-Bb H-Mn L-Bb L-Mn 

Sequence:
TRINLTLVSELADQHLMAEYRELPRVFGAVRKHVANGKRVRDFKISPTFILGAGHVTFFY
DKLEFLRKRQIELIAECLKRGFNIKDTTVQ
Structures of the domain P04418 2-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2fcc X-ray 2.3 A 2-91  H-Bb H-Mn L-Bb L-Mn 
2fcc X-ray 2.3 B 2-91  H-Bb H-Mn L-Bb L-Mn 
1vas X-ray 2.75 A 2-91  H-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text