Pfam domain
Pfam family: TetR_N (PF00440.25)
Uniprot AC: P04483
RecName: Tetracycline repressor protein class B from transposon Tn10
Begin-End: 9-55
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VINSALELLNEVGIEGLTTRKLAQKLGVEQPTLYWHVKNKRALLDAL
Structures of the domain P04483 9-55
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6sy6 X-ray 2.9 B 9-55 None
6sy6 X-ray 2.9 A 9-55 None
6sy4 X-ray 2.7 A 9-55 None
6sy4 X-ray 2.7 B 9-55 None


© NPIDB team 2003 - 2021

text