Pfam domain
Pfam family: AGT (PF11440.10)
Uniprot AC: P04519
RecName: DNA alpha-glucosyltransferase
Begin-End: 14-368
Organism: Enterobacteria phage T4
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 

Sequence:
CGVTKFSLEQRDWFIKNGHEVTLVYAKDKSFTRTSSHDHKSFSIPVILAKEYDKALKLVN
DCDILIINSVPATSVQEATINNYKKLLDNIKPSIRVVVYQHDHSVLSLRRNLGLEETVRR
ADVIFSHSDNGDFNKVLMKEWYPETVSLFDDIEEAPTVYNFQPPMDIVKVRSTYWKDVSE
INMNINRWIGRTTTWKGFYQMFDFHEKFLKPAGKSTVMEGLERSPAFIAIKEKGIPYEYY
GNREIDKMNLAPNQPAQILDCYINSEMLERMSKSGFGYQLSKLNQKYLQRSLEYTHLELG
ACGTIPVFWKSTGENLKFRVDNTPLTSHDSGIIWFDENDMESTFERIKELSSDRA
Structures of the domain P04519 14-368
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1y6f X-ray 2.4 B 1014-1368 None
1y6f X-ray 2.4 A 1014-1368 None
1y8z X-ray 1.9 A 1013-1368  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
1y6g X-ray 2.8 A 1014-1368  H-Bb H-Mj H-Mn L-Bb L-Mj L-Mn 
1y6g X-ray 2.8 B 1014-1368 None


© NPIDB team 2003 - 2021

text