Pfam domain
Pfam family: AGT (PF11440.10)
Uniprot AC: P04519
RecName: DNA alpha-glucosyltransferase
Begin-End: 143-340
Organism: Enterobacteria phage T4
Interaction Mode:  H-Bb H-Mj H-Mn L-Bb 

Sequence:
NGDFNKVLMKEWYPETVSLFDDIEEAPTVYNFQPPMDIVKVRSTYWKDVSEINMNINRWI
GRTTTWKGFYQMFDFHEKFLKPAGKSTVMEGLERSPAFIAIKEKGIPYEYYGNREIDKMN
LAPNQPAQILDCYINSEMLERMSKSGFGYQLSKLNQKYLQRSLEYTHLELGACGTIPVFW
KSTGENLKFRVDNTPLTS
Structures of the domain P04519 143-340
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1y8z X-ray 1.9 B 1141-1368  H-Bb H-Mj H-Mn L-Bb 


© NPIDB team 2003 - 2021

text