Pfam domain
Pfam family: AGT (PF11440.10)
Uniprot AC: P04519
RecName: DNA alpha-glucosyltransferase
Begin-End: 16-144
Organism: Enterobacteria phage T4
Interaction Mode:  H-Bb H-Mn 

Sequence:
VTKFSLEQRDWFIKNGHEVTLVYAKDKSFTRTSSHDHKSFSIPVILAKEYDKALKLVNDC
DILIINSVPATSVQEATINNYKKLLDNIKPSIRVVVYQHDHSVLSLRRNLGLEETVRRAD
VIFSHSDNG
Structures of the domain P04519 16-144
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ya6 X-ray 2.4 B 1014-1169 None
1y8z X-ray 1.9 B 1013-1171  H-Bb H-Mn 


© NPIDB team 2003 - 2021

text