Pfam domain
Pfam family: AGT (PF11440.10)
Uniprot AC: P04519
RecName: DNA alpha-glucosyltransferase
Begin-End: 16-150
Organism: Enterobacteria phage T4
Interaction Mode:   

Sequence:
VTKFSLEQRDWFIKNGHEVTLVYAKDKSFTRTSSHDHKSFSIPVILAKEYDKALKLVNDC
DILIINSVPATSVQEATINNYKKLLDNIKPSIRVVVYQHDHSVLSLRRNLGLEETVRRAD
VIFSHSDNGDFNKVL
Structures of the domain P04519 16-150
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1ya6 X-ray 2.4 A 1014-1169 None


© NPIDB team 2003 - 2021

text