Pfam domain
Pfam family: RVT_connect (PF06815.15)
Uniprot AC: P04585
RecName: Gag-Pol polyprotein
Begin-End: 905-1006
Organism: Human immunodeficiency virus type 1 group M subtype B (isolate HXB2)
Interaction Mode:  H-Bb S-Bb L-Bb L-Mj 

Sequence:
YYDPSKDLIAEIQKQGQGQWTYQIYQEPFKNLKTGKYARMRGAHTNDVKQLTEAVQKITT
ESIVIWGKTPKFKLPIQKETWETWWTEYWQATWIPEWEFVNT
Structures of the domain P04585 905-1006
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3kk1 X-ray 2.7 B 318-419  H-Bb 
3kk1 X-ray 2.7 A 318-419  S-Bb L-Bb 
1rtd X-ray 3.2 D 318-419  H-Bb 
1rtd X-ray 3.2 B 318-419 None
6or7 X-ray 2.53 B 318-419  S-Bb 
6or7 X-ray 2.53 A 318-419  S-Bb L-Bb 
3kk2 X-ray 2.9 A 318-419  S-Bb L-Bb 
3kk2 X-ray 2.9 B 318-419 None
3kjv X-ray 3.1 B 318-419  H-Bb 
3kjv X-ray 3.1 A 318-419  S-Bb L-Bb 
1t05 X-ray 3 B 318-419  H-Bb 
3kk3 X-ray 2.9 A 318-419  H-Bb S-Bb L-Bb 
3kk3 X-ray 2.9 B 318-419  H-Bb 
5j2p X-ray 2.53 B 318-419  H-Bb S-Bb 
5j2p X-ray 2.53 A 318-419  S-Bb L-Bb 
6bsj X-ray 2.89 A 318-419 None
6bsj X-ray 2.89 B 318-419 None
4b3q X-ray 5 B 318-419 None
4b3q X-ray 5 A 318-419 None
6p2g X-ray 2.99 B 318-419  H-Bb 
6p2g X-ray 2.99 A 318-419  S-Bb L-Bb 
6bsi X-ray 3.25 B 318-419 None
6bsi X-ray 3.25 A 318-419 None
6p1x X-ray 2.55 B 318-419  H-Bb 
6p1x X-ray 2.55 A 318-419  S-Bb L-Bb L-Mj 
5j2m X-ray 2.43 B 318-419  S-Bb 
5j2m X-ray 2.43 A 318-419  S-Bb L-Bb 
6ujx X-ray 2.7 B 318-419 None
6ujx X-ray 2.7 A 318-419  S-Bb L-Bb 
6p1i X-ray 2.74 B 318-419  H-Bb 
6p1i X-ray 2.74 A 318-419  S-Bb L-Bb 
6waz X-ray 4.1 B 318-419 None
6bsg X-ray 2.44 A 318-419 None
6bsg X-ray 2.44 B 318-419 None
6uir X-ray 2.64 B 318-419  H-Bb 
6uir X-ray 2.64 A 318-419  S-Bb L-Bb 
6bsh X-ray 2.65 B 318-419 None
6bsh X-ray 2.65 A 318-419 None
6otz X-ray 2.86 B 318-419 None
6otz X-ray 2.86 A 318-419  S-Bb L-Bb 
6uis X-ray 2.75 B 318-419  H-Bb 
6uis X-ray 2.75 A 318-419  S-Bb L-Bb 
6ujy X-ray 2.59 B 318-419 None
6ujy X-ray 2.59 A 318-419  S-Bb L-Bb 
6uk0 X-ray 2.76 B 318-419  H-Bb 
6uk0 X-ray 2.76 A 318-419  H-Bb S-Bb L-Bb 
6wb0 X-ray 4.2 B 318-419 None
6wb0 X-ray 4.2 A 318-419 None
6ujz X-ray 2.56 B 318-419 None
6ujz X-ray 2.56 A 318-419  S-Bb L-Bb 
6wb2 X-ray 4.5 B 318-419 None
6wb2 X-ray 4.5 A 318-419 None
6wb1 X-ray 4.7 B 318-419 None
5j2n X-ray 2.9 B 318-419  S-Bb 
5j2n X-ray 2.9 A 318-419  S-Bb L-Bb 
5j2q X-ray 2.79 B 318-419  S-Bb 
5j2q X-ray 2.79 A 318-419  S-Bb L-Bb 
4b3p X-ray 4.84 B 318-419 None
4b3p X-ray 4.84 A 318-419 None
4b3o X-ray 3.3 B 318-419 None
4b3o X-ray 3.3 A 318-419 None
6uit X-ray 2.81 B 318-419 None
6uit X-ray 2.81 A 318-419  S-Bb L-Bb 
6wpj X-ray 2.73 B 318-419  S-Bb 
6wpj X-ray 2.73 A 318-419  S-Bb L-Bb 
6wph X-ray 2.72 A 318-419  S-Bb L-Bb 
6wph X-ray 2.72 B 318-419  S-Bb 
6wpf X-ray 2.53 A 318-419  S-Bb L-Bb 
6wpf X-ray 2.53 B 318-419  H-Bb S-Bb 


© NPIDB team 2003 - 2021

text