Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P04908
RecName: Histone H2A type 1-B/E
Begin-End: 10-91
Organism: Homo sapiens
Interaction Mode:  H-Bb S-Bb S-Mn L-Bb L-Mn 

Sequence:
KARAKAKTRSSRAGLQFPVGRVHRLLRKGNYSERVGAGAPVYLAAVLEYLTAEILELAGN
AARDNKKTRIIPRHLQLAIRND
Structures of the domain P04908 10-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6r8y X-ray 4.3 G 10-91  H-Bb S-Bb L-Bb 
6r8y X-ray 4.3 C 10-91  H-Bb S-Bb L-Bb 
6e0p X-ray 2.6 G 9-90  H-Bb S-Bb L-Bb L-Mn 
6e0p X-ray 2.6 C 10-90  H-Bb S-Bb L-Bb L-Mn 
5gse X-ray 3.14 G 9-90  H-Bb S-Bb L-Bb 
6t7d X-ray 4.4 G 9-90  H-Bb L-Bb 
6t7d X-ray 4.4 C 9-90  H-Bb L-Bb 
6t79 X-ray 3.2 G 9-90  H-Bb S-Bb L-Bb L-Mn 
6t79 X-ray 3.2 C 9-90  H-Bb S-Bb L-Bb L-Mn 
6r94 X-ray 3.5 G 9-91  H-Bb S-Bb L-Bb L-Mn 
6r94 X-ray 3.5 C 9-91  H-Bb S-Bb L-Bb 
7k60 X-ray 3.12 G 10-90  H-Bb S-Bb L-Bb L-Mn 
7k60 X-ray 3.12 C 10-90  H-Bb S-Bb L-Bb L-Mn 
6e0c X-ray 2.63 G 9-90  H-Bb S-Bb L-Bb 
6e0c X-ray 2.63 C 10-90  H-Bb S-Bb L-Bb L-Mn 
5jrg X-ray 2.5 G 10-90  H-Bb S-Bb S-Mn L-Bb L-Mn 
6yov X-ray 3.42 G 9-91  H-Bb S-Bb 
6yov X-ray 3.42 C 9-91  H-Bb S-Bb L-Bb 
6r8z X-ray 3.9 G 10-91  H-Bb S-Bb L-Bb 
6r8z X-ray 3.9 C 10-91  H-Bb S-Bb L-Bb 
6o1d X-ray 3.4 G 9-90  H-Bb S-Bb L-Bb L-Mn 
6o1d X-ray 3.4 C 10-90  H-Bb S-Bb L-Bb 
6t90 X-ray 3.05 G 10-91  H-Bb S-Bb L-Bb 
6t90 X-ray 3.05 C 9-91  H-Bb S-Bb 
6r92 X-ray 4.8 G 10-91  H-Bb S-Bb L-Bb 
6r92 X-ray 4.8 C 10-91  H-Bb S-Bb L-Bb L-Mn 
6r91 X-ray 4.1 G 10-91  H-Bb S-Bb L-Bb L-Mn 
6r91 X-ray 4.1 C 11-91  H-Bb S-Bb L-Bb 
6la8 X-ray 3.4 C 10-90  H-Bb S-Bb L-Bb 
7k63 X-ray 3.03 C 10-90  H-Bb S-Bb L-Bb L-Mn 
7k63 X-ray 3.03 G 10-90  H-Bb S-Bb L-Bb L-Mn 
7k5x X-ray 2.93 C 10-90  H-Bb S-Bb L-Bb L-Mn 
7k5x X-ray 2.93 G 10-90  H-Bb S-Bb L-Bb L-Mn 
7k61 X-ray 2.85 C 10-90  H-Bb S-Bb L-Bb L-Mn 
7k61 X-ray 2.85 G 10-90  H-Bb S-Bb L-Bb L-Mn 
7k5y X-ray 2.76 C 10-90  H-Bb S-Bb L-Bb L-Mn 
7k5y X-ray 2.76 G 10-90  H-Bb S-Bb L-Bb L-Mn 


© NPIDB team 2003 - 2021

text