Pfam domain
Pfam family: DNA_methylase (PF00145.19)
Uniprot AC: P05102
RecName: Modification methylase HhaI
Begin-End: 12-320
Organism: Haemophilus parahaemolyticus
Interaction Mode:  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 

Sequence:
LRFIDLFAGLGGFRLALESCGAECVYSNEWDKYAQEVYEMNFGEKPEGDITQVNEKTIPD
HDILCAGFPCQAFSISGKQKGFEDSRGTLFFDIARIVREKKPKVVFMENVKNFASHDNGN
TLEVVKNTMNELDYSFHAKVLNALDYGIPQKRERIYMICFRNDLNIQNFQFPKPFELNTF
VKDLLLPDSEVEHLVIDRKDLVMTNQEIEQTTPKTVRLGIVGKGGQGERIYSTRGIAITL
SAYGGGIFAKTGGYLVNGKTRKLHPRECARVMGYPDSYKVHPSTSQAYKQFGNSVVINVL
QYIAYNIGS
Structures of the domain P05102 12-320
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3eeo X-ray 1.94 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1skm X-ray 2.2 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2uyc X-ray 2 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
4mht X-ray 2.7 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2z6a X-ray 2.88 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2zcj X-ray 2.75 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
9mht X-ray 2.39 A 12-320  S-Bb S-Mj L-Bb L-Mj L-Mn 
2z6u X-ray 2.72 A 12-320  H-Bb S-Mj L-Bb L-Mj L-Mn 
6mht X-ray 2.05 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2c7r X-ray 1.9 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1m0e X-ray 2.5 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
8mht X-ray 2.76 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2c7p X-ray 1.7 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
5mht X-ray 2.7 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2uyh X-ray 2.63 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
3mht X-ray 2.7 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
10mh X-ray 2.55 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2i9k X-ray 2.65 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2hr1 X-ray 1.96 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
7mht X-ray 2.87 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2c7q X-ray 1.85 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2z6q X-ray 2.79 A 12-320  H-Bb L-Bb L-Mj 
1fjx X-ray 2.26 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
1mht X-ray 2.6 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2uz4 X-ray 2.1 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
5ciy X-ray 1.59 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 
2c7o X-ray 1.9 A 12-320  H-Bb S-Bb S-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text