Pfam domain
Pfam family: DNA_photolyase (PF00875.20)
Uniprot AC: P05327
RecName: Deoxyribodipyrimidine photo-lyase
Begin-End: 5-170
Organism: Synechococcus sp.
Interaction Mode:   

Sequence:
ILFWHRRDLRLSDNIGLAAARAQSAQLIGLFCLDPQILQSADMAPARVAYLQGCLQELQQ
RYQQAGSRLLLLQGDPQHLIPQLAQQLQAEAVYWNQDIEPYGRDRDGQVAAALKTAGIRA
VQLWDQLLHSPDQILSGSGNPYSVYGPFWKNWQAQPKPTPVATPTE
Structures of the domain P05327 5-170
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1tez X-ray 1.8 D 5-170 None
1tez X-ray 1.8 C 5-170 None
1tez X-ray 1.8 B 5-170 None
1tez X-ray 1.8 A 5-170 None


© NPIDB team 2003 - 2021

text