Pfam domain
Pfam family: Methylase_S (PF01420.21)
Uniprot AC: P05719
RecName: Type-1 restriction enzyme EcoKI specificity protein
Begin-End: 307-405
Organism: Escherichia coli
Interaction Mode:   

Sequence:
KKLQHQNLLYPDKLIRARLTKDALPEYIEIFFSSPSARNAMMNCVKTTSGQKGISGKDIK
SQVVLLPPVKEQAEIVRRVEQLFAYADTIEKQVNNALAR
Structures of the domain P05719 307-405
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2y7h X-ray 18 A 307-405  L-Mj 


© NPIDB team 2003 - 2021

text