Pfam domain
Pfam family: Sigma54_CBD (PF04963.15)
Uniprot AC: P06223
RecName: RNA polymerase sigma-54 factor
Begin-End: 112-303
Organism: Klebsiella oxytoca
Interaction Mode:   

Sequence:
YQGETTQSLQDYLMWQVELTPFTDTDRAIATSIVDAVDDTGYLTISVEDIVESIGDDEIG
LEEVEAVLKRIQRFDPVGVAAKDLRDCLLVQLSQFAKETPWIEEARLIISDHLDLLANHD
FRSLMRVTRLKEEVLKEAVNLIQSLDPRPGQSIQTGEPEYVIPDVLVRKVNDRWVVELNS
DSLPRLKINQQY
Structures of the domain P06223 112-303
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gfw X-ray 3.7 M 112-263 None


© NPIDB team 2003 - 2021

text