Pfam domain
Pfam family: Sigma54_DBD (PF04552.15)
Uniprot AC: P06223
RecName: RNA polymerase sigma-54 factor
Begin-End: 335-473
Organism: Klebsiella oxytoca
Interaction Mode:   

Sequence:
SRNDTLLRVSRCIVEQQQAFFEQGEEFMKPMVLADIAQAVEMHESTISRVTTQKYLHSPR
GIFELKYFFSSHVNTEGGGEASSTAIRALVKKLIAAENPAKPLSDSKLTTMLSDQGIMVA
RRTVAKYRESLSIPPSNQR
Structures of the domain P06223 335-473
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6gh6 X-ray 4.1 M 290-473 None


© NPIDB team 2003 - 2021

text