Pfam domain
Pfam family: Sigma70_r1_2 (PF00140.22)
Uniprot AC: P06224
RecName: RNA polymerase sigma factor SigA
Begin-End: 100-133
Organism: Bacillus subtilis
Interaction Mode:   

Sequence:
DPVRMYLKEIGRVNLLSAKEEIAYAQKIEEGDEE
Structures of the domain P06224 100-133
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7ckq X-ray 4.4 F 100-133 None


© NPIDB team 2003 - 2021

text