Pfam domain
Pfam family: Penicillinase_R (PF03965.18)
Uniprot AC: P06555
RecName: Penicillinase repressor
Begin-End: 7-82
Organism: Bacillus licheniformis
Interaction Mode:   

Sequence:
ISDAELEVMKVIWKHSSINTNEVIKELSKTSTWSPKTIQTMLLRLIKKGALNHHKEGRVF
VYTPNIDESDYIEVKS
Structures of the domain P06555 7-82
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2p7c NMR B 7-82  H-Bb H-Mj S-Bb S-Mj L-Bb 


© NPIDB team 2003 - 2021

text