Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: P06612
RecName: DNA topoisomerase 1
Begin-End: 4-142
Organism: Escherichia coli
Interaction Mode:   

Sequence:
ALVIVESPAKAKTINKYLGSDYVVKSSVGHIRDLPTSGSAAKKSADSTSTKTAKKPKKDE
RGALVNRMGVDPWHNWEAHYEVLPGKEKVVSELKQLAEKADHIYLATDLDREGEAIAWHL
REVIGGDDARYSRVVFNEI
Structures of the domain P06612 4-142
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3px7 X-ray 2.3 A 4-142 None
4rul X-ray 2.9 A 4-142 None
1mw8 X-ray 1.9 X 4-142 None


© NPIDB team 2003 - 2021

text