Pfam domain
Pfam family: DNA_pol_B_thumb (PF14791.8)
Uniprot AC: P06746
RecName: DNA polymerase beta
Begin-End: 268-334
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 

Sequence:
GVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKY
REPKDRS
Structures of the domain P06746 268-334
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
7icl X-ray 3.1 A 269-333 None
7icq X-ray 2.9 A 269-333 None
3isb X-ray 2 A 269-333  L-Bb 
7icu X-ray 3.3 A 269-333 None
5vrz X-ray 2.05 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5vs0 X-ray 2.1 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5vs1 X-ray 2.5 A 269-333  S-Bb L-Bb 
5vs3 X-ray 1.7 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
9icy X-ray 3 A 269-333 None
8ici X-ray 2.8 A 269-333 None
4klh X-ray 1.88 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
1zqj X-ray 3.3 A 269-333 None
8icq X-ray 3 A 269-333 None
1zqn X-ray 3 A 269-333 None
4f5o X-ray 2 A 269-333 None
7icv X-ray 2.8 A 269-333 None
4tuq X-ray 2.37 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4gxi X-ray 1.95 A 269-333 None
7ici X-ray 2.8 A 269-333 None
2pxi X-ray 2.1 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
9icv X-ray 2.7 A 269-333 None
8ich X-ray 3.3 A 269-333 None
1zqt X-ray 3.4 A 269-333 None
2p66 X-ray 2.5 A 269-333 None
6nkv X-ray 1.85 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
8icp X-ray 2.9 A 269-333 None
1zqo X-ray 3.2 A 269-333 None
7icr X-ray 3 A 269-333 None
5vez X-ray 2.04 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
9icc X-ray 3.1 A 269-333 None
5bpc X-ray 2 A 269-333 None
3jpn X-ray 2.15 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
1zqk X-ray 3.2 A 269-333 None
3jpo X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
9icp X-ray 3.1 A 269-333 None
8ick X-ray 2.7 A 269-333 None
4ub3 X-ray 2.06 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
3rjg X-ray 2 A 269-333 None
9ici X-ray 3.1 A 269-333 None
1zqb X-ray 3.2 A 269-333 None
7icn X-ray 2.8 A 269-333 None
7ice X-ray 2.8 A 269-333 None
2isp X-ray 2.2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
7ics X-ray 2.8 A 269-333 None
8icx X-ray 3 A 269-333 None
4gxk X-ray 2 A 269-333 None
1zqh X-ray 3.1 A 269-333 None
1zql X-ray 3.3 A 269-333 None
9icg X-ray 3 A 269-333 None
9icr X-ray 3 A 269-333 None
5u2r X-ray 1.8 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6n2r X-ray 2.1 A 269-333 None
7ict X-ray 2.8 A 269-333 None
3gdx X-ray 2.2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
9ico X-ray 2.9 A 269-333 None
9icx X-ray 2.6 A 269-333 None
1zqc X-ray 3.2 A 269-333 None
9icq X-ray 2.9 A 269-333 None
8icj X-ray 3.2 A 269-333 None
7icf X-ray 3.1 A 269-333 None
1bpx X-ray 2.4 A 269-333 None
1tva X-ray 2.6 A 269-333  H-Mn 
9ice X-ray 3.3 A 269-333 None
7ick X-ray 2.9 A 269-333 None
9icf X-ray 3 A 269-333 None
2i9g X-ray 2.1 A 269-333 None
8ica X-ray 3 A 269-333 None
1zqm X-ray 3.2 A 269-333 None
8icy X-ray 3.1 A 269-333 None
3jpp X-ray 2.1 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
1zqi X-ray 2.7 A 269-333 None
1tv9 X-ray 2 A 269-333 None
3jpr X-ray 2.1 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
8icr X-ray 2.9 A 269-333 None
4mff X-ray 2.55 A 269-333 None
1zqr X-ray 3.7 A 269-333 None
8icv X-ray 3.2 A 269-333 None
5db7 X-ray 2.21 A 269-333 None
2fmp X-ray 1.65 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4klt X-ray 1.98 A 269-333 None
8icm X-ray 2.9 A 269-333 None
2iso X-ray 2.1 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
7ich X-ray 2.9 A 269-333 None
3jps X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
3rjh X-ray 2.2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
1zqf X-ray 2.9 A 269-333 None
9icl X-ray 2.8 A 269-333 None
7icm X-ray 3 A 269-333 None
9ict X-ray 3 A 269-333 None
6e3x X-ray 2.65 A 269-333  L-Bb 
4rq4 X-ray 2.1 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4rq5 X-ray 2.32 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4rq6 X-ray 2.25 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4rq7 X-ray 2 A 269-333 None
4rq8 X-ray 2 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
3jpq X-ray 1.9 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4ph5 X-ray 2.55 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb 
8ice X-ray 3.2 A 269-333 None
1mq2 X-ray 3.1 A 269-333 None
5ugo X-ray 1.9 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
3jpt X-ray 2.15 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
9ich X-ray 2.9 A 269-333 None
5wo0 X-ray 1.6 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
8icw X-ray 3.3 A 269-333 None
8icc X-ray 2.8 A 269-333 None
9icj X-ray 3.1 A 269-333 None
1zqa X-ray 3.2 A 269-333 None
2fmq X-ray 2.2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
1zqs X-ray 3.3 A 269-333 None
1bpz X-ray 2.6 A 269-333  H-Bb H-Mn L-Bb 
9ick X-ray 2.7 A 269-333 None
3c2l X-ray 2.6 A 269-333 None
5hhi X-ray 2.52 A 269-333 None
5hhh X-ray 2.36 A 269-333 None
5v1p X-ray 1.99 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
1zqp X-ray 2.8 A 269-333 None
9ics X-ray 2.9 A 269-333 None
8ict X-ray 3.1 A 269-333 None
5vrw X-ray 2.58 A 269-333  H-Bb H-Mn S-Bb L-Bb 
9icb X-ray 3.2 A 269-333 None
4p2h X-ray 1.99 A 269-333 None
4m47 X-ray 2.37 A 269-333 None
4ubb X-ray 1.9 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
1mq3 X-ray 2.8 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
8icg X-ray 3.3 A 269-333 None
8ico X-ray 2.7 A 269-333 None
1zqg X-ray 3.1 A 269-333 None
4pgx X-ray 2.08 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
8icb X-ray 3.1 A 269-333 None
3c2m X-ray 2.15 A 269-333 None
7icj X-ray 3.5 A 269-333 None
4ub5 X-ray 2.15 A 269-333  H-Bb H-Mn S-Bb L-Bb 
7ico X-ray 3.3 A 269-333 None
6nkt X-ray 2.6 A 269-333 None
1zqd X-ray 3.5 A 269-333 None
9icn X-ray 3 A 269-333 None
4m2y X-ray 2.27 A 269-333 None
8icu X-ray 3 A 269-333 None
1zqq X-ray 3.3 A 269-333 None
2fms X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6cr9 X-ray 1.96 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4klq X-ray 2 A 269-333 None
9ica X-ray 3 A 269-333 None
8icl X-ray 3.1 A 269-333 None
4uaz X-ray 1.88 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
8icz X-ray 3.1 A 269-333 None
8icn X-ray 2.8 A 269-333 None
6n2s X-ray 2.46 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
3c2k X-ray 2.4 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
7icp X-ray 3 A 269-333 None
9icu X-ray 2.9 A 269-333 None
1zjm X-ray 2.1 A 269-333 None
3mby X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
8icf X-ray 2.9 A 269-333 None
1zqe X-ray 3.7 A 269-333 None
9icm X-ray 2.9 A 269-333 None
3rjk X-ray 2.1 A 269-333  H-Bb H-Mn S-Bb L-Bb 
5wnx X-ray 2.55 A 269-333  H-Bb H-Mn S-Bb L-Bb 
6nkr X-ray 2.45 A 269-333  H-Mn S-Bb L-Bb L-Mn 
7icg X-ray 3 A 269-333 None
3lk9 X-ray 2.5 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4mf2 X-ray 2.4 A 269-333 None
8ics X-ray 2.9 A 269-333 None
5v1f X-ray 2.18 A 269-333  H-Mn S-Bb L-Bb 
3rh4 X-ray 1.92 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
3rh5 X-ray 2.1 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
3rh6 X-ray 2.05 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6uom X-ray 2.05 A 269-333  S-Bb L-Bb 
6uok X-ray 2.55 F 269-333 None
6uok X-ray 2.55 A 269-333 None
4doa X-ray 2.05 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6ctk X-ray 2.15 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
3rje X-ray 2.1 A 269-333 None
3rjj X-ray 2 A 269-333 None
3rji X-ray 2.3 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
3rjf X-ray 2.3 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5ugn X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4doc X-ray 1.95 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
3tfr X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
3tfs X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5tba X-ray 2.49 A 269-325 None
5v1i X-ray 2.04 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4do9 X-ray 2.05 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4dob X-ray 2.05 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5vry X-ray 1.9 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5dba X-ray 1.97 A 269-333 None
5v1h X-ray 1.95 A 269-333 None
6cua X-ray 2.17 A 269-333  L-Bb 
6cly X-ray 2.19 A 269-333 None
4rt2 X-ray 1.92 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5u2s X-ray 2.3 A 269-333 None
4rpx X-ray 1.9 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4rpy X-ray 1.9 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4rpz X-ray 2.19 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4rq0 X-ray 2.2 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4nln X-ray 2.26 A 269-333  L-Bb 
5ugp X-ray 1.96 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6cr5 X-ray 1.98 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4jwm X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4rt3 X-ray 1.92 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4tur X-ray 2.17 A 269-333  L-Bb 
3isd X-ray 2.6 A 269-333 None
6nks X-ray 2.35 A 269-333  H-Mn S-Bb L-Bb L-Mn 
5u9h X-ray 1.85 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
6dia X-ray 1.97 A 269-333 None
5v1j X-ray 2.62 A 269-333  H-Bb 
4m9h X-ray 2.39 A 269-333  L-Bb 
6cpq X-ray 1.93 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6pkz X-ray 2.74 A 269-333 None
6ph5 X-ray 2.6 A 269-333 None
4m9n X-ray 2.27 A 269-333 None
4ub4 X-ray 1.95 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4m9l X-ray 2.09 A 269-333  H-Mn 
5j0u X-ray 2.1 A 269-333 None
4nlk X-ray 2.49 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4nm2 X-ray 2.52 A 269-333  H-Bb 
6nkz X-ray 2.01 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5wnz X-ray 2.2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4nlz X-ray 2.68 A 269-333 None
4nm1 X-ray 2.42 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4o9m X-ray 2.29 A 269-333 None
4mfc X-ray 2.13 A 269-333 None
4ny8 X-ray 2.25 A 269-333 None
4o5c X-ray 2.36 A 269-333 None
4o5e X-ray 2.53 A 269-333 None
4o5k X-ray 2.06 A 269-333  H-Bb H-Mn S-Bb L-Bb 
6e3w X-ray 2.02 A 269-333  H-Bb H-Mn S-Bb L-Bb 
5j0r X-ray 2 A 269-333 None
5j0s X-ray 2 A 269-333 None
5j0t X-ray 2 A 269-333  H-Mn L-Bb L-Mn 
4klf X-ray 1.85 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5j2g X-ray 2.1 A 269-333  H-Mn S-Bb L-Bb L-Mn 
5j2h X-ray 2.3 A 269-333  H-Bb S-Bb L-Bb 
5j2i X-ray 2.4 A 269-333  S-Bb L-Bb 
4mf8 X-ray 2.32 A 269-333  L-Bb 
4mfa X-ray 2.27 A 269-333 None
4r63 X-ray 1.85 A 269-333 None
6e3v X-ray 1.96 A 269-333  H-Bb S-Bb L-Bb 
5j2j X-ray 2.2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5j2k X-ray 2.1 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4r64 X-ray 2.2 A 269-333 None
4r65 X-ray 1.95 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4r66 X-ray 2.25 A 269-333  L-Bb L-Mn 
4pgq X-ray 2.3 A 269-333 None
5j0o X-ray 2 A 269-333 None
5j0p X-ray 2.2 A 269-333 None
5j0q X-ray 2 A 269-333  L-Bb 
5j0w X-ray 2.4 A 269-333 None
5j0x X-ray 2 A 269-333 None
5j0y X-ray 2 A 269-333 None
5j29 X-ray 2.2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5j2a X-ray 2.5 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5j2b X-ray 2.5 A 269-333  H-Bb S-Bb L-Bb L-Mn 
5j2c X-ray 2.1 A 269-333  H-Bb S-Bb L-Bb 
5j2d X-ray 2.1 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5j2e X-ray 2.1 A 269-333  H-Bb S-Bb L-Bb L-Mn 
5j2f X-ray 2.1 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4rq1 X-ray 2.7 A 269-333 None
4rq2 X-ray 2.2 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4rq3 X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5vs2 X-ray 2.33 A 269-333  H-Bb H-Mn L-Bb L-Mn 
4klm X-ray 1.75 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4ub1 X-ray 2.34 A 269-331 None
6ctt X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4uay X-ray 1.98 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4phe X-ray 2.15 A 269-333 None
6crh X-ray 2.33 A 269-333 None
4z6c X-ray 2.68 A 269-333  H-Bb H-Mn S-Bb L-Bb 
1zjn X-ray 2.61 A 269-333  H-Mn S-Bb L-Bb L-Mn 
4ub2 X-ray 2.51 A 269-333 None
5vs4 X-ray 1.87 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4klj X-ray 1.8 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4ubc X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5db8 X-ray 2.55 A 269-333 None
5dbb X-ray 2.25 A 269-333 None
3isc X-ray 2 A 269-333 None
4kll X-ray 1.84 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4uaw X-ray 1.9 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6nku X-ray 1.9 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5v1g X-ray 1.8 A 269-333  L-Bb 
6nkx X-ray 1.98 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5dbc X-ray 2.4 A 269-333  L-Bb 
6ctu X-ray 1.9 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5db9 X-ray 2.45 A 269-333 None
4pha X-ray 2.52 A 269-333 None
5v1o X-ray 1.8 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5vrx X-ray 2.2 A 269-333  H-Bb H-Mn S-Bb L-Bb 
4phd X-ray 2.21 A 269-333 None
6mr7 X-ray 2.14 A 269-333  L-Bb 
6cr7 X-ray 2.29 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5tzv X-ray 2 A 269-333 None
5u2t X-ray 1.79 A 269-333 None
4kld X-ray 1.92 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5u8g X-ray 2.17 A 269-333  L-Bb 
5eoz X-ray 2.09 A 269-333  H-Bb H-Mn S-Bb L-Bb 
4tus X-ray 2.42 A 269-333  H-Bb 
4kle X-ray 1.97 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4klo X-ray 1.85 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4ppx X-ray 2.08 A 269-333  L-Bb L-Mn 
4klg X-ray 1.7 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
4ymn X-ray 2.59 A 269-333  L-Bb 
4kli X-ray 1.6 A 269-333  H-Bb H-Mj H-Mn S-Bb L-Bb L-Mn 
5db6 X-ray 2.83 A 269-333 None
6ctn X-ray 1.92 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6nl0 X-ray 1.97 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5v1r X-ray 2.08 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4klu X-ray 1.97 A 269-333 None
4f5p X-ray 1.85 A 269-333 None
6uol X-ray 1.94 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4kls X-ray 1.98 A 269-333 None
5bom X-ray 2 A 269-333 None
4m9g X-ray 2.01 A 269-333  L-Bb L-Mn 
4m9j X-ray 2.04 A 269-333 None
4lvs X-ray 2 A 269-333 None
3ogu X-ray 1.85 A 269-333 None
9icw X-ray 2.6 A 269-333 None
6ctl X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6cr4 X-ray 1.8 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6bem X-ray 1.88 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6ctp X-ray 2.2 A 269-333  S-Bb L-Bb 
6ctw X-ray 1.98 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6cr3 X-ray 1.95 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6btf X-ray 1.75 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6ctx X-ray 2.02 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6ctq X-ray 1.87 A 269-333  H-Bb S-Bb L-Bb L-Mn 
6cto X-ray 2.04 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6cr6 X-ray 2.1 A 269-333  H-Mn S-Bb L-Bb L-Mn 
4ymo X-ray 2.15 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6crb X-ray 2.15 A 269-333  S-Bb L-Bb 
5tb8 X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6bel X-ray 1.9 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4z6f X-ray 2.44 A 269-333  H-Bb H-Mn S-Bb L-Bb 
6ctv X-ray 2.02 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4z6e X-ray 2.75 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4yn4 X-ray 2.24 A 269-333 None
4z6d X-ray 2.51 A 269-333  L-Bb 
6cr8 X-ray 2.05 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6g2q X-ray 2.15 A 269-333  H-Bb S-Bb L-Bb L-Mn 
6crc X-ray 2.3 A 269-333  S-Bb L-Bb L-Mn 
6ctr X-ray 1.85 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6ctm X-ray 2.1 A 269-333  H-Bb S-Bb L-Bb L-Mn 
6ctj X-ray 2.1 A 269-333  S-Bb L-Bb L-Mn 
6cti X-ray 2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
1bpy X-ray 2.2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4nxz X-ray 2.56 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6ph6 X-ray 2.6 A 269-333  S-Bb L-Bb 
6e3r X-ray 2.26 A 269-333 None
6nky X-ray 2.09 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4gxj X-ray 2.2 A 269-333  H-Bb H-Mn S-Bb L-Bb 
5bol X-ray 1.98 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6n2t X-ray 2.6 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6mr8 X-ray 1.9 A 269-333 None
6w2m X-ray 2 A 269-333  S-Bb L-Bb 
6bte X-ray 2.2 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5u8i X-ray 2.45 A 269-333  L-Bb 
4f5q X-ray 2.25 A 269-333  H-Bb S-Bb L-Bb 
4f5n X-ray 1.8 A 269-333 None
6u2o X-ray 2.3 A 269-333 None
6cub X-ray 2.05 A 269-333 None
5v1n X-ray 2.01 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4jwn X-ray 2.39 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
6nkw X-ray 1.98 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
5tb9 X-ray 2.49 A 269-333  H-Bb S-Bb L-Bb 
5wny X-ray 2.1 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4ymm X-ray 2.2 A 269-333 None
6cu9 X-ray 2.04 A 269-333  H-Bb H-Mn S-Bb L-Bb 
5u8h X-ray 2.16 A 269-333  L-Bb 
4tup X-ray 1.8 A 266-330 None
6dic X-ray 1.99 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4f5r X-ray 2.2 A 269-333 None
4f5r X-ray 2.2 B 269-333  H-Bb H-Mn S-Bb L-Bb 
4php X-ray 2.6 A 269-333  H-Bb H-Mn S-Bb L-Bb L-Mn 
4pgy X-ray 2.26 A 269-333 None
6u6b X-ray 3.11 A 269-333  L-Bb 


© NPIDB team 2003 - 2021

text