Pfam domain
Pfam family: HHH_8 (PF14716.8)
Uniprot AC: P06766
RecName: DNA polymerase beta
Begin-End: 12-78
Organism: Rattus norvegicus
Interaction Mode:   

Sequence:
NGGITDMLVELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAE
KIDEFLA
Structures of the domain P06766 12-78
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1huo X-ray 2.6 A 12-78 None
1huo X-ray 2.6 B 12-78 None
2bpf X-ray 2.9 A 12-78 None
2bpg X-ray 3.6 A 12-78 None
2bpg X-ray 3.6 B 12-78 None
3v7j X-ray 2.25 A 12-78 None
1huz X-ray 2.6 A 12-78 None
1huz X-ray 2.6 B 12-78 None
3v72 X-ray 2.49 A 12-78 None
3uxp X-ray 2.72 A 12-78 None
3uxp X-ray 2.72 B 12-78 None
3v7k X-ray 2.27 A 12-78 None


© NPIDB team 2003 - 2021

text