Pfam domain
Pfam family: DNA_pol_B_palm (PF14792.8)
Uniprot AC: P06766
RecName: DNA polymerase beta
Begin-End: 149-262
Organism: Rattus norvegicus
Interaction Mode:  S-Bb S-Mn L-Bb 

Sequence:
RIPREEMLQMQDIVLNEVKKLDPEYIATVCGSFRRGAESSGDMDVLLTHPNFTSESSKQP
KLLHRVVEQLQKVRFITDTLSKGETKFMGVCQLPSENDENEYPHRRIDIRLIPK
Structures of the domain P06766 149-262
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1huo X-ray 2.6 A 149-262  S-Bb S-Mn 
1huo X-ray 2.6 B 149-262  S-Bb S-Mn L-Bb 
2bpf X-ray 2.9 A 149-262  S-Bb L-Bb 
2bpg X-ray 3.6 A 149-262  S-Bb L-Bb 
2bpg X-ray 3.6 B 149-262  S-Bb S-Mn L-Bb 
3v7j X-ray 2.25 A 149-262  S-Bb L-Bb 
1huz X-ray 2.6 A 149-262  S-Bb S-Mn L-Bb 
1huz X-ray 2.6 B 149-262  S-Bb S-Mn L-Bb 
3v72 X-ray 2.49 A 149-262  S-Bb S-Mn L-Bb 
3uxp X-ray 2.72 A 149-262  S-Bb L-Bb 
3uxp X-ray 2.72 B 149-262  S-Bb L-Bb 
3v7k X-ray 2.27 A 149-262  S-Bb L-Bb 


© NPIDB team 2003 - 2021

text