Pfam domain
Pfam family: DNA_pol_lambd_f (PF10391.11)
Uniprot AC: P06766
RecName: DNA polymerase beta
Begin-End: 98-147
Organism: Rattus norvegicus
Interaction Mode:  H-Bb L-Bb 

Sequence:
NFLTRVTGIGPSAARKLVDEGIKTLEDLRKNEDKLNHHQRIGLKYFEDFE
Structures of the domain P06766 98-147
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1huo X-ray 2.6 A 98-147  H-Bb L-Bb 
1huo X-ray 2.6 B 98-147  H-Bb L-Bb 
2bpf X-ray 2.9 A 98-147  H-Bb L-Bb 
2bpg X-ray 3.6 A 98-147  H-Bb L-Bb 
2bpg X-ray 3.6 B 98-147  H-Bb L-Bb 
3v7j X-ray 2.25 A 98-147  H-Bb L-Bb 
1huz X-ray 2.6 A 98-147  H-Bb L-Bb 
1huz X-ray 2.6 B 98-147  H-Bb L-Bb 
3v72 X-ray 2.49 A 98-147  H-Bb L-Bb 
3uxp X-ray 2.72 A 98-147  H-Bb L-Bb 
3uxp X-ray 2.72 B 98-147  H-Bb L-Bb 
3v7k X-ray 2.27 A 98-147  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text