Pfam domain
Pfam family: DNA_gyraseB (PF00204.27)
Uniprot AC: P06786
RecName: DNA topoisomerase 2
Begin-End: 246-408
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
NFKNYVELYLKSLEKKRQLDNGEDGAAKSDIPTILYERINNRWEVAFAVSDISFQQISFV
NSIATTMGGTHVNYITDQIVKKISEILKKKKKKSVKSFQIKNNMFIFINCLIENPAFTSQ
TKEQLTTRVKDFGSRCEIPLEYINKIMKTDLATRMFEIADANE
Structures of the domain P06786 246-408
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4gfh X-ray 4.41 F 247-373 None
4gfh X-ray 4.41 A 247-373 None


© NPIDB team 2003 - 2021

text