Pfam domain
Pfam family: Toprim (PF01751.24)
Uniprot AC: P06786
RecName: DNA topoisomerase 2
Begin-End: 444-559
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
TLVLTEGDSALSLAVAGLAVVGRDYYGCYPLRGKMLNVREASADQILKNAEIQAIKKIMG
LQHRKKYEDTKSLRYGHLMIMTDQDHDGSHIKGLIINFLESSFPGLLDIQGFLLEF
Structures of the domain P06786 444-559
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
3l4j X-ray 2.48 A 444-559  H-Bb S-Bb L-Bb 
3l4k X-ray 2.98 A 444-559  H-Bb S-Bb L-Bb 
2rgr X-ray 3 A 444-559  H-Bb S-Bb L-Bb L-Mn 
4gfh X-ray 4.41 F 444-559  H-Bb L-Bb 
4gfh X-ray 4.41 A 444-559  H-Bb L-Bb 


© NPIDB team 2003 - 2021

text