Pfam domain
Pfam family: HBB (PF06777.13)
Uniprot AC: P06839
RecName: General transcription and DNA repair factor IIH helicase subunit XPD
Begin-End: 270-415
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
RISEVRKVDSQKLQDEYEKLVQGLHSADILTDQEEPFVETPVLPQDLLTEAIPGNIRRAE
HFVSFLKRLIEYLKTRMKVLHVISETPKSFLQHLKQLTFIERKPLRFCSERLSLLVRTLE
VTEVEDFTALKDIATFATLISTYEEG
Structures of the domain P06839 270-415
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5oqj X-ray 4.7 0 270-415 None
5oqm X-ray 5.8 0 270-415 None
6gym X-ray 6.7 0 270-415 None
5sva X-ray 15.3 Y 295-491 None


© NPIDB team 2003 - 2021

text