Pfam domain
Pfam family: Helicase_C_2 (PF13307.8)
Uniprot AC: P06839
RecName: General transcription and DNA repair factor IIH helicase subunit XPD
Begin-End: 526-699
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LVEFAKITPDGMVVFFPSYLYMESIVSMWQTMGILDEVWKHKLILVETPDAQETSLALET
YRKACSNGRGAILLSVARGKVSEGIDFDHQYGRTVLMIGIPFQYTESRILKARLEFMREN
YRIRENDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLADRRFSRKRSQLPKWIAQ
Structures of the domain P06839 526-699
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fmf X-ray 6 Y 526-702 None
5oqj X-ray 4.7 0 526-700 None
5oqm X-ray 5.8 0 526-700 None
6gym X-ray 6.7 0 526-700 None
5sva X-ray 15.3 Y 526-703 None


© NPIDB team 2003 - 2021

text