Pfam domain
Pfam family: DEAD_2 (PF06733.17)
Uniprot AC: P06839
RecName: General transcription and DNA repair factor IIH helicase subunit XPD
Begin-End: 71-257
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YCSRTMSEIEKALVELENLMDYRTKELGYQEDFRGLGLTSRKNLCLHPEVSKERKGTVVD
EKCRRMTNGQAKRKLEEDPEANVELCEYHENLYNIEVEDYLPKGVFSFEKLLKYCEEKTL
CPYFIVRRMISLCNIIIYSYHYLLDPKIAERVSNEVSKDSIVIFDEAHNIDNVCIESLSL
DLTTDAL
Structures of the domain P06839 71-257
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5fmf X-ray 6 Y 71-257 None
5oqj X-ray 4.7 0 71-257 None
5oqm X-ray 5.8 0 71-257 None
6gym X-ray 6.7 0 71-257 None
5sva X-ray 15.3 Y 71-257 None


© NPIDB team 2003 - 2021

text