Pfam domain
Pfam family: Myb_DNA-bind_6 (PF13921.8)
Uniprot AC: P06876
RecName: Transcriptional activator Myb
Begin-End: 97-155
Organism: Mus musculus
Interaction Mode:   

Sequence:
KEEDQRVIELVQKYGPKRWSVIAKHLKGRIGKQCRERWHNHLNPEVKKTSWTEEEDRII
Structures of the domain P06876 97-155
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1msf NMR C 95-153  H-Bb H-Mj L-Bb 
1mse NMR C 95-153  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text