Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P06897
RecName: Histone H2A type 1
Begin-End: 13-91
Organism: Xenopus laevis
Interaction Mode:  H-Bb S-Bb S-Mn L-Bb 

Sequence:
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAAR
DNKKTRIIPRHLQLAVRND
Structures of the domain P06897 13-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6kix X-ray 4.1 G 13-90  S-Bb L-Bb 
6kix X-ray 4.1 C 11-90  H-Bb L-Bb 
3kwq X-ray 3.5 G 14-90  H-Bb S-Bb L-Bb 
3kwq X-ray 3.5 C 14-90  H-Bb S-Bb L-Bb 
6fq6 X-ray 4 G 10-90 None
6fq6 X-ray 4 C 10-90 None
3uta X-ray 2.07 G 14-90 None
3uta X-ray 2.07 C 14-90 None
6pww X-ray 4.4 I 12-90  H-Bb S-Bb L-Bb 
6pww X-ray 4.4 M 12-90  H-Bb S-Bb L-Bb 
6kw4 X-ray 7.55 S 12-90  S-Bb S-Mn L-Bb L-Mn 
6kw4 X-ray 7.55 O 12-90  H-Bb S-Bb S-Mn L-Bb L-Mn 
2fj7 X-ray 3.2 G 14-90  H-Bb S-Bb L-Bb 
2fj7 X-ray 3.2 C 14-90  H-Bb L-Bb 
3kuy X-ray 2.9 G 14-90 None
3kuy X-ray 2.9 C 14-90 None
3c1c X-ray 3.15 C 814-890  H-Bb S-Bb L-Bb 
3c1c X-ray 3.15 G 1016-1090  H-Bb S-Bb L-Bb 
4j8v X-ray 2.58 G 14-90 None
4j8v X-ray 2.58 C 14-90 None
4j8v X-ray 2.58 G 14-90 None
4j8v X-ray 2.58 C 14-90 None
4j8x X-ray 2.87 G 14-90 None
4j8x X-ray 2.87 C 14-90 None
4j8x X-ray 2.87 G 14-90 None
4j8x X-ray 2.87 C 14-90 None
7crp X-ray 3.2 G 10-90  H-Bb S-Bb L-Mn 
7crp X-ray 3.2 C 10-90  H-Bb S-Bb L-Bb L-Mn 
1m1a X-ray 2.65 G 1014-1090  H-Bb S-Bb S-Mn L-Bb 
1m1a X-ray 2.65 C 814-890  H-Bb S-Bb L-Bb 
2nzd X-ray 2.65 G 14-90 None
2nzd X-ray 2.65 C 14-90 None
1aoi X-ray 2.8 G 12-90  H-Bb S-Bb L-Bb 
3b6f X-ray 3.45 G 13-90 None
3b6f X-ray 3.45 C 15-90 None
3b6g X-ray 3.45 G 13-90 None
3b6g X-ray 3.45 C 15-90 None
3o62 X-ray 3.22 G 14-90  H-Bb S-Bb L-Bb 
3o62 X-ray 3.22 C 14-90  H-Bb S-Bb L-Bb 
3rei X-ray 2.65 G 14-90 None
3rei X-ray 2.65 C 14-90 None
6ne3 X-ray 3.9 G 11-90  H-Bb S-Bb L-Bb 
1s32 X-ray 2.05 C 812-890  H-Bb S-Bb L-Bb 
1s32 X-ray 2.05 G 1013-1090  H-Bb S-Bb S-Mn L-Bb 
1m19 X-ray 2.3 G 1015-1090  H-Bb S-Bb L-Bb 
1m19 X-ray 2.3 C 814-890  H-Bb S-Bb L-Bb 
6kiu X-ray 3.2 G 13-90  H-Bb S-Bb 
6kiu X-ray 3.2 C 11-90  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 G 12-90  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 C 12-90  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 G 12-90  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 C 12-90  H-Bb S-Bb L-Bb 
3reh X-ray 2.5 C 14-90 None
3reh X-ray 2.5 G 14-90 None
3utb X-ray 2.2 G 14-90 None
3utb X-ray 2.2 C 16-90 None
3rej X-ray 2.55 G 14-90 None
3rej X-ray 2.55 C 16-90 None
3rek X-ray 2.6 G 14-90 None
3rek X-ray 2.6 C 16-90 None
3rel X-ray 2.7 C 16-90 None
3rel X-ray 2.7 G 14-90 None
3ut9 X-ray 2.2 G 16-90 None
3ut9 X-ray 2.2 C 14-90 None
1m18 X-ray 2.45 G 1014-1090  H-Bb S-Bb L-Bb 
1m18 X-ray 2.45 C 814-890  H-Bb S-Bb L-Bb 
6fq8 X-ray 4.8 C 13-90 None
6fq8 X-ray 4.8 G 12-90 None
4r8p X-ray 3.28 G 12-90 None
3c1b X-ray 2.2 G 1016-1090  H-Bb S-Bb L-Bb 
3c1b X-ray 2.2 C 814-890  H-Bb S-Bb L-Bb 
3lja X-ray 2.75 G 13-90 None
3lja X-ray 2.75 C 15-90 None
1zbb X-ray 9 g 13-90  H-Bb S-Bb L-Bb L-Mn 
1zbb X-ray 9 c 10-90  H-Bb S-Bb L-Bb 
1zbb X-ray 9 G 13-90  H-Bb S-Bb L-Bb L-Mn 
1zbb X-ray 9 C 10-90  H-Bb S-Bb L-Bb 
6fq5 X-ray 3.8 G 9-90 None
6fq5 X-ray 3.8 C 9-90 None
6pa7 X-ray 2.94 G 10-90  H-Bb S-Bb L-Bb 
6pa7 X-ray 2.94 C 11-90  H-Bb S-Bb L-Bb 
6o96 X-ray 3.5 G 12-90  H-Bb S-Bb L-Bb 
6o96 X-ray 3.5 C 12-90  H-Bb S-Bb L-Bb 
5f99 X-ray 2.63 G 9-90 None
5f99 X-ray 2.63 C 11-90 None
6kw3 X-ray 7.13 S 12-90  H-Bb S-Bb L-Bb 
6kw3 X-ray 7.13 O 12-90  H-Bb S-Bb 
5z3o X-ray 3.62 G 12-90  H-Bb L-Bb 
5z3o X-ray 3.62 C 12-90  H-Bb L-Bb 
6r1t X-ray 3.7 G 10-90 None
6r1t X-ray 3.7 C 13-90 None
6x0n X-ray 10 G 11-91 None
6x0n X-ray 10 g 11-90 None
6x0n X-ray 10 C 10-90 None
6iy3 X-ray 3.67 G 9-90  H-Bb S-Bb L-Bb L-Mn 
6iy3 X-ray 3.67 C 11-90  H-Bb S-Bb L-Bb 
6iro X-ray 3.4 C 12-90  H-Bb S-Bb L-Bb 
6iro X-ray 3.4 G 12-90  H-Bb S-Bb L-Bb 
6pwv X-ray 6.2 M 12-90  H-Bb S-Bb L-Bb 
6pwv X-ray 6.2 I 12-90  H-Bb S-Bb L-Bb 
6iy2 X-ray 3.47 G 9-90  H-Bb S-Bb L-Bb L-Mn 
6iy2 X-ray 3.47 C 11-90  H-Bb S-Bb 
6uxw X-ray 8.96 X 12-90  H-Bb S-Bb L-Bb 
6uxw X-ray 8.96 T 12-90  H-Bb S-Bb L-Bb 
1zla X-ray 2.9 G 1014-1090  H-Bb S-Bb L-Bb 
1zla X-ray 2.9 C 814-890  H-Bb S-Bb L-Bb 
3mnn X-ray 2.5 G 14-90 None
3mnn X-ray 2.5 C 14-90 None
6ven X-ray 3.37 G 13-90  H-Bb L-Bb 
6kiz X-ray 4.5 G 13-90  S-Bb L-Bb 
6kiz X-ray 4.5 C 11-90  H-Bb S-Bb L-Bb 
6pwx X-ray 4.2 M 12-90  H-Bb S-Bb L-Bb 
6pwx X-ray 4.2 I 12-90  H-Bb S-Bb L-Bb 
1kx3 X-ray 2 G 14-90 None
1kx3 X-ray 2 C 14-90 None
1kx4 X-ray 2.6 G 14-90 None
1kx4 X-ray 2.6 C 16-90 None
1p34 X-ray 2.7 G 1013-1090  H-Bb S-Bb L-Bb 
1p34 X-ray 2.7 C 812-890  H-Bb S-Bb L-Bb 
1p3a X-ray 3 G 1016-1090  H-Bb S-Bb L-Bb 
1p3a X-ray 3 C 814-890  H-Bb S-Bb L-Bb 
1p3b X-ray 3 G 1015-1090  H-Bb S-Bb L-Bb 
1p3b X-ray 3 C 813-890  H-Bb S-Bb L-Bb 
1p3f X-ray 2.9 G 1013-1090  H-Bb S-Bb L-Bb 
1p3f X-ray 2.9 C 815-890  H-Bb S-Bb L-Bb 
1p3g X-ray 2.7 G 1012-1090  H-Bb S-Bb L-Bb 
1p3g X-ray 2.7 C 814-890  H-Bb S-Bb L-Bb 
1p3i X-ray 2.3 G 1016-1090  H-Bb S-Bb L-Bb 
1p3i X-ray 2.3 C 815-890  H-Bb S-Bb L-Bb 
1p3k X-ray 2.9 C 815-890  H-Bb S-Bb L-Bb 
1p3k X-ray 2.9 G 1014-1090  H-Bb S-Bb L-Bb 
1p3l X-ray 2.4 C 815-890  H-Bb S-Bb L-Bb 
1p3l X-ray 2.4 G 1011-1090  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 G 1015-1090  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 C 814-890  H-Bb S-Bb L-Bb 
1p3o X-ray 2.75 G 1014-1090  H-Bb S-Bb L-Bb 
1p3o X-ray 2.75 C 814-890  H-Bb S-Bb L-Bb 
1p3p X-ray 2.7 G 1012-1090  H-Bb S-Bb L-Bb 
1p3p X-ray 2.7 C 814-890  H-Bb S-Bb L-Bb 
4j8u X-ray 2.38 G 14-90 None
4j8u X-ray 2.38 C 14-90 None
6kw5 X-ray 10.13 O 12-90  H-Bb S-Bb L-Bb 
6om3 X-ray 3.3 G 12-90  H-Bb S-Bb L-Bb 
6om3 X-ray 3.3 S 12-90  H-Bb S-Bb L-Bb 
6om3 X-ray 3.3 O 12-90  H-Bb S-Bb L-Bb 
6nqa X-ray 3.54 C 12-90  H-Bb S-Bb L-Bb 
6nqa X-ray 3.54 G 11-90  H-Bb S-Bb L-Bb 
4j8w X-ray 2.41 G 14-90 None
4j8w X-ray 2.41 C 14-90 None
5x0y X-ray 4.69 G 12-90  H-Bb S-Bb L-Bb 
5x0y X-ray 4.69 C 12-90  H-Bb S-Bb L-Bb 
6s01 X-ray 3.2 G 12-90 None
6s01 X-ray 3.2 C 12-90 None
5x0x X-ray 3.97 G 12-90  H-Bb S-Bb L-Bb 
5x0x X-ray 3.97 C 12-90  H-Bb S-Bb L-Bb 
6kiw X-ray 4 C 12-90  H-Bb S-Bb L-Bb 
6kiv X-ray 4 G 13-90  S-Bb L-Bb 
6kiv X-ray 4 C 11-90  H-Bb S-Bb L-Bb 
5z3l X-ray 4.31 G 12-90  H-Bb L-Bb 
5z3l X-ray 4.31 C 12-90  H-Bb L-Bb 
7crr X-ray 3.48 C 10-90  H-Bb S-Bb L-Bb 
7crr X-ray 3.48 G 10-90  S-Bb L-Bb 
7crq X-ray 3.15 C 10-90  H-Bb S-Bb L-Mn 
7crq X-ray 3.15 G 10-90  H-Bb S-Bb L-Mn 
6wz9 X-ray 2.8 G 11-90 None
7cro X-ray 3.75 C 10-90  H-Bb S-Bb L-Bb 
7cro X-ray 3.75 G 10-90  H-Bb S-Bb L-Mn 
6wz5 X-ray 2.2 C 10-90 None
6wz5 X-ray 2.2 G 10-90 None
6nj9 X-ray 2.96 C 11-90  H-Bb S-Bb L-Bb 
6nj9 X-ray 2.96 G 11-90  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text