Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P06897
RecName: Histone H2A type 1
Begin-End: 13-91
Organism: Xenopus laevis
Interaction Mode:  H-Bb S-Bb S-Mn L-Bb 

Sequence:
AKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAAR
DNKKTRIIPRHLQLAVRND
Structures of the domain P06897 13-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wu8 X-ray 2.45 G 18-88 None
4wu8 X-ray 2.45 C 18-88 None
4wu9 X-ray 2.6 G 18-88 None
4wu9 X-ray 2.6 C 18-88 None
6kix X-ray 4.1 G 17-88  S-Bb L-Bb 
6kix X-ray 4.1 C 15-88  H-Bb L-Bb 
3kwq X-ray 3.5 G 18-88  H-Bb S-Bb L-Bb 
3kwq X-ray 3.5 C 18-88  H-Bb S-Bb L-Bb 
6g0l X-ray 10 G 18-88 None
6g0l X-ray 10 C 19-88 None
5o9g X-ray 4.8 G 18-88 None
5o9g X-ray 4.8 C 19-88 None
6ryr X-ray 3.1 C 19-88 None
6ryr X-ray 3.1 G 18-88 None
6fq6 X-ray 4 G 15-88 None
6fq6 X-ray 4 C 15-88 None
5onw X-ray 2.8 G 18-88 None
5onw X-ray 2.8 C 18-88 None
3uta X-ray 2.07 G 18-88 None
3uta X-ray 2.07 C 18-88 None
5oy7 X-ray 5.77 e 43-113 None
5oy7 X-ray 5.77 C 19-88 None
5oy7 X-ray 5.77 G 18-88 None
5oy7 X-ray 5.77 K 19-88 None
5oy7 X-ray 5.77 S 19-88 None
5oy7 X-ray 5.77 W 18-88 None
5oy7 X-ray 5.77 O 18-88 None
5oy7 X-ray 5.77 a 19-88 None
5dnm X-ray 2.81 G 18-88 None
5dnm X-ray 2.81 C 18-88 None
5dnn X-ray 2.8 G 18-88 None
5dnn X-ray 2.8 C 18-88 None
6pww X-ray 4.4 I 16-88  H-Bb S-Bb L-Bb 
6pww X-ray 4.4 M 16-88  H-Bb S-Bb L-Bb 
6kw4 X-ray 7.55 S 16-88  S-Bb S-Mn L-Bb 
6kw4 X-ray 7.55 O 16-88  H-Bb S-Bb S-Mn L-Bb 
2fj7 X-ray 3.2 G 18-88  H-Bb S-Bb L-Bb 
2fj7 X-ray 3.2 C 18-88  H-Bb L-Bb 
6ltj X-ray 3.7 G 18-88 None
6ltj X-ray 3.7 C 19-88 None
5nl0 X-ray 5.4 M 18-88 None
5nl0 X-ray 5.4 G 19-88 None
5nl0 X-ray 5.4 C 18-88 None
3kuy X-ray 2.9 G 18-88 None
3kuy X-ray 2.9 C 18-88 None
6ftx X-ray 4.5 C 19-88 None
6ftx X-ray 4.5 G 18-88 None
3c1c X-ray 3.15 C 818-888  H-Bb S-Bb L-Bb 
3c1c X-ray 3.15 G 1019-1088  H-Bb S-Bb L-Bb 
4j8v X-ray 2.58 G 18-88 None
4j8v X-ray 2.58 C 18-88 None
4j8v X-ray 2.58 G 18-88 None
4j8v X-ray 2.58 C 18-88 None
4j8x X-ray 2.87 G 18-88 None
4j8x X-ray 2.87 C 18-88 None
4j8x X-ray 2.87 G 18-88 None
4j8x X-ray 2.87 C 18-88 None
7crp X-ray 3.2 G 15-88  H-Bb S-Bb 
7crp X-ray 3.2 C 15-88  H-Bb S-Bb L-Bb 
1m1a X-ray 2.65 G 1018-1088  H-Bb S-Bb S-Mn L-Bb 
1m1a X-ray 2.65 C 818-888  H-Bb S-Bb L-Bb 
2nzd X-ray 2.65 G 18-88 None
2nzd X-ray 2.65 C 18-88 None
5e5a X-ray 2.81 G 18-88  H-Bb S-Bb L-Bb 
5e5a X-ray 2.81 C 18-88  H-Bb S-Bb L-Bb 
1aoi X-ray 2.8 G 16-88  H-Bb S-Bb L-Bb 
4ys3 X-ray 3 G 1018-1088  H-Bb S-Bb L-Bb 
4ys3 X-ray 3 C 818-888  H-Bb S-Bb L-Bb 
3b6f X-ray 3.45 G 17-88 None
3b6f X-ray 3.45 C 18-88 None
3b6g X-ray 3.45 G 17-88 None
3b6g X-ray 3.45 C 18-88 None
3o62 X-ray 3.22 G 18-88  H-Bb S-Bb L-Bb 
3o62 X-ray 3.22 C 18-88  H-Bb S-Bb L-Bb 
3rei X-ray 2.65 G 18-88 None
3rei X-ray 2.65 C 18-88 None
6ne3 X-ray 3.9 G 15-88  H-Bb S-Bb L-Bb 
6ne3 X-ray 3.9 C 12-88  H-Bb S-Bb L-Bb 
5mlu X-ray 2.8 G 18-88 None
5mlu X-ray 2.8 C 19-88 None
1s32 X-ray 2.05 C 816-888  H-Bb S-Bb L-Bb 
1s32 X-ray 2.05 G 1017-1088  H-Bb S-Bb S-Mn L-Bb 
1m19 X-ray 2.3 G 1018-1088  H-Bb S-Bb L-Bb 
1m19 X-ray 2.3 C 818-888  H-Bb S-Bb L-Bb 
6nog X-ray 3.9 G 18-88  H-Bb S-Bb L-Bb 
6nog X-ray 3.9 C 18-88  H-Bb S-Bb L-Bb 
6kiu X-ray 3.2 G 17-88  H-Bb S-Bb 
6kiu X-ray 3.2 C 15-88  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 G 16-88  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 C 16-88  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 G 16-88  H-Bb S-Bb L-Bb 
3tu4 X-ray 3 C 16-88  H-Bb S-Bb L-Bb 
3reh X-ray 2.5 C 18-88 None
3reh X-ray 2.5 G 18-88 None
5hq2 X-ray 4.5 G 18-88 None
3utb X-ray 2.2 G 18-88 None
3utb X-ray 2.2 C 19-88 None
3rej X-ray 2.55 G 18-88 None
3rej X-ray 2.55 C 19-88 None
3rek X-ray 2.6 G 18-88 None
3rek X-ray 2.6 C 19-88 None
3rel X-ray 2.7 C 19-88 None
3rel X-ray 2.7 G 18-88 None
4xzq X-ray 2.4 G 1018-1088  H-Bb S-Bb L-Bb 
4xzq X-ray 2.4 C 818-888  H-Bb S-Bb L-Bb 
3ut9 X-ray 2.2 G 19-88 None
3ut9 X-ray 2.2 C 18-88 None
1m18 X-ray 2.45 G 1018-1088  H-Bb S-Bb L-Bb 
1m18 X-ray 2.45 C 818-888  H-Bb S-Bb L-Bb 
6fq8 X-ray 4.8 C 17-88 None
6fq8 X-ray 4.8 G 16-88 None
6nj9 X-ray 2.96 C 15-88  H-Bb S-Bb L-Bb 
6nj9 X-ray 2.96 G 15-88  H-Bb S-Bb L-Bb 
6ryu X-ray 4 C 19-88 None
6ryu X-ray 4 G 18-88 None
4r8p X-ray 3.28 G 16-88 None
4r8p X-ray 3.28 C 19-88 None
3c1b X-ray 2.2 G 1019-1088  H-Bb S-Bb L-Bb 
3c1b X-ray 2.2 C 818-888  H-Bb S-Bb L-Bb 
3lja X-ray 2.75 G 17-88 None
3lja X-ray 2.75 C 18-88 None
1zbb X-ray 9 g 17-88  H-Bb S-Bb L-Bb 
1zbb X-ray 9 c 17-88  H-Bb S-Bb L-Bb 
1zbb X-ray 9 G 17-88  H-Bb S-Bb L-Bb 
1zbb X-ray 9 C 17-88  H-Bb S-Bb L-Bb 
4xuj X-ray 3.18 G 18-88 None
4xuj X-ray 3.18 C 18-88 None
6fq5 X-ray 3.8 G 13-88 None
6fq5 X-ray 3.8 C 13-88 None
6pa7 X-ray 2.94 G 15-88  H-Bb S-Bb L-Bb 
6pa7 X-ray 2.94 C 15-88  H-Bb S-Bb L-Bb 
6o96 X-ray 3.5 G 16-88  H-Bb S-Bb L-Bb 
6o96 X-ray 3.5 C 16-88  H-Bb S-Bb L-Bb 
5f99 X-ray 2.63 G 13-88 None
5f99 X-ray 2.63 C 15-88 None
6kw3 X-ray 7.13 S 16-88  H-Bb S-Bb L-Bb 
6kw3 X-ray 7.13 O 16-88  H-Bb S-Bb 
5z3o X-ray 3.62 G 16-88  H-Bb L-Bb 
5z3o X-ray 3.62 C 16-88  H-Bb L-Bb 
5cp6 X-ray 2.6 G 18-88 None
5cp6 X-ray 2.6 C 18-88 None
5omx X-ray 2.32 C 18-88 None
5omx X-ray 2.32 G 19-88 None
5ong X-ray 2.8 G 18-88 None
5ong X-ray 2.8 C 18-88 None
4z66 X-ray 2.5 G 1018-1088  H-Bb S-Bb L-Bb 
4z66 X-ray 2.5 C 818-888  H-Bb S-Bb L-Bb 
6r1t X-ray 3.7 G 15-88 None
6r1t X-ray 3.7 C 17-88 None
6x0n X-ray 10 G 16-89 None
6x0n X-ray 10 g 15-88 None
6x0n X-ray 10 c 13-82 None
6x0n X-ray 10 C 15-88 None
6iy3 X-ray 3.67 G 13-88  H-Bb S-Bb L-Bb L-Mn 
6iy3 X-ray 3.67 C 15-88  H-Bb S-Bb L-Bb 
5xf6 X-ray 2.63 C 18-88 None
5xf6 X-ray 2.63 G 18-88 None
6iro X-ray 3.4 C 16-88  H-Bb S-Bb L-Bb 
6iro X-ray 3.4 G 16-88  H-Bb S-Bb L-Bb 
6pwv X-ray 6.2 M 16-88  H-Bb S-Bb L-Bb 
6pwv X-ray 6.2 I 16-88  H-Bb S-Bb L-Bb 
4zux X-ray 3.82 Q 18-88 None
4zux X-ray 3.82 M 19-88 None
4zux X-ray 3.82 G 10-80 None
4zux X-ray 3.82 C 19-88 None
6iy2 X-ray 3.47 G 13-88  H-Bb S-Bb L-Bb L-Mn 
6iy2 X-ray 3.47 C 15-88  H-Bb S-Bb 
6uxw X-ray 8.96 X 16-88  H-Bb S-Bb L-Bb 
6uxw X-ray 8.96 T 16-88  H-Bb S-Bb L-Bb 
6r25 X-ray 4.61 G 12-88 None
6i84 X-ray 4.4 Q 19-88 None
6i84 X-ray 4.4 V 18-88 None
5oxv X-ray 6.72 C 19-88 None
5oxv X-ray 6.72 M 19-88 None
5oxv X-ray 6.72 G 18-88 None
5oxv X-ray 6.72 Q 18-88 None
1zla X-ray 2.9 G 1018-1088  H-Bb S-Bb L-Bb 
1zla X-ray 2.9 C 818-888  H-Bb S-Bb L-Bb 
3mnn X-ray 2.5 G 18-88 None
3mnn X-ray 2.5 C 18-88 None
6nn6 X-ray 3.9 G 18-88 None
6nn6 X-ray 3.9 C 18-88 None
6ven X-ray 3.37 C 18-88  H-Bb S-Bb L-Bb 
6ven X-ray 3.37 G 17-88  H-Bb L-Bb 
6r1u X-ray 4.36 G 12-88 None
6r1u X-ray 4.36 C 19-88 None
6kiz X-ray 4.5 G 17-88  S-Bb L-Bb 
6kiz X-ray 4.5 C 15-88  H-Bb S-Bb L-Bb 
6t9l X-ray 3.6 G 18-88 None
6t9l X-ray 3.6 C 19-88 None
6pwx X-ray 4.2 M 16-88  H-Bb S-Bb L-Bb 
6pwx X-ray 4.2 I 16-88  H-Bb S-Bb L-Bb 
6vyp X-ray 4.99 G 18-88 None
6vyp X-ray 4.99 C 19-88 None
6vyp X-ray 4.99 g 17-87 None
6vyp X-ray 4.99 c 19-88 None
1kx3 X-ray 2 G 18-88 None
1kx3 X-ray 2 C 18-88 None
1kx4 X-ray 2.6 G 18-88 None
1kx4 X-ray 2.6 C 19-88 None
1p34 X-ray 2.7 G 1017-1088  H-Bb S-Bb L-Bb 
1p34 X-ray 2.7 C 816-888  H-Bb S-Bb L-Bb 
1p3a X-ray 3 G 1019-1088  H-Bb S-Bb L-Bb 
1p3a X-ray 3 C 818-888  H-Bb S-Bb L-Bb 
1p3b X-ray 3 G 1018-1088  H-Bb S-Bb L-Bb 
1p3b X-ray 3 C 817-888  H-Bb S-Bb L-Bb 
1p3f X-ray 2.9 G 1017-1088  H-Bb S-Bb L-Bb 
1p3f X-ray 2.9 C 818-888  H-Bb S-Bb L-Bb 
1p3g X-ray 2.7 G 1016-1088  H-Bb S-Bb L-Bb 
1p3g X-ray 2.7 C 818-888  H-Bb S-Bb L-Bb 
1p3i X-ray 2.3 G 1019-1088  H-Bb S-Bb L-Bb 
1p3i X-ray 2.3 C 818-888  H-Bb S-Bb L-Bb 
1p3k X-ray 2.9 C 818-888  H-Bb S-Bb L-Bb 
1p3k X-ray 2.9 G 1018-1088  H-Bb S-Bb L-Bb 
1p3l X-ray 2.4 C 818-888  H-Bb S-Bb L-Bb 
1p3l X-ray 2.4 G 1015-1088  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 G 1018-1088  H-Bb S-Bb L-Bb 
1p3m X-ray 2.9 C 818-888  H-Bb S-Bb L-Bb 
1p3o X-ray 2.75 G 1018-1088  H-Bb S-Bb L-Bb 
1p3o X-ray 2.75 C 818-888  H-Bb S-Bb L-Bb 
1p3p X-ray 2.7 G 1016-1088  H-Bb S-Bb L-Bb 
1p3p X-ray 2.7 C 818-888  H-Bb S-Bb L-Bb 
4j8u X-ray 2.38 G 18-88 None
4j8u X-ray 2.38 C 18-88 None
6kw5 X-ray 10.13 O 16-88  H-Bb S-Bb L-Bb 
6kw5 X-ray 10.13 T 18-88  H-Bb 
6tda X-ray 15 G 18-88  H-Bb S-Bb L-Bb 
6tda X-ray 15 C 18-88  H-Bb S-Bb 
6om3 X-ray 3.3 G 16-88  H-Bb S-Bb L-Bb 
6om3 X-ray 3.3 C 18-88  S-Bb L-Bb 
6om3 X-ray 3.3 S 16-88  H-Bb S-Bb L-Bb 
6om3 X-ray 3.3 O 16-88  H-Bb S-Bb L-Bb 
6nqa X-ray 3.54 C 16-88  H-Bb S-Bb L-Bb 
6nqa X-ray 3.54 G 15-88  H-Bb S-Bb L-Bb 
4j8w X-ray 2.41 G 18-88 None
4j8w X-ray 2.41 C 18-88 None
5x0y X-ray 4.69 G 16-88  H-Bb S-Bb L-Bb 
5x0y X-ray 4.69 C 16-88  H-Bb S-Bb L-Bb 
6s01 X-ray 3.2 G 16-88 None
6s01 X-ray 3.2 C 16-88 None
6tem X-ray 3.9 G 18-88 None
6tem X-ray 3.9 C 18-88 None
5x0x X-ray 3.97 G 16-88  H-Bb S-Bb L-Bb 
5x0x X-ray 3.97 C 16-88  H-Bb S-Bb L-Bb 
6kiw X-ray 4 G 18-88  H-Bb S-Bb L-Bb 
6kiw X-ray 4 C 16-88  H-Bb S-Bb L-Bb 
6kiv X-ray 4 G 17-88  S-Bb L-Bb 
6kiv X-ray 4 C 15-88  H-Bb S-Bb L-Bb 
5z3l X-ray 4.31 G 16-88  H-Bb L-Bb 
5z3l X-ray 4.31 C 16-88  H-Bb L-Bb 
7crr X-ray 3.48 C 15-88  H-Bb S-Bb L-Bb 
7crr X-ray 3.48 G 15-88  S-Bb L-Bb 
7crq X-ray 3.15 C 15-88  H-Bb S-Bb 
7crq X-ray 3.15 G 15-88  H-Bb S-Bb 
6wz9 X-ray 2.8 C 19-88 None
6wz9 X-ray 2.8 G 15-88 None
7cro X-ray 3.75 C 15-88  H-Bb S-Bb L-Bb 
7cro X-ray 3.75 G 15-88  H-Bb S-Bb 
6wz5 X-ray 2.2 C 15-88 None
6wz5 X-ray 2.2 G 15-88 None


© NPIDB team 2003 - 2021

text