Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P06897
RecName: Histone H2A type 1
Begin-End: 19-91
Organism: Xenopus laevis
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
SSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLTAEILELAGNAARDNKKTR
IIPRHLQLAVRND
Structures of the domain P06897 19-91
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4wu8 X-ray 2.45 G 14-90 None
4wu8 X-ray 2.45 C 14-90 None
4wu9 X-ray 2.6 G 14-90 None
4wu9 X-ray 2.6 C 14-90 None
6g0l X-ray 10 G 14-90 None
6g0l X-ray 10 C 16-90 None
5o9g X-ray 4.8 G 14-90 None
5o9g X-ray 4.8 C 16-90 None
6ryr X-ray 3.1 C 16-90 None
6ryr X-ray 3.1 G 14-90 None
5onw X-ray 2.8 G 14-90 None
5onw X-ray 2.8 C 15-90 None
5oy7 X-ray 5.77 e 39-115 None
5oy7 X-ray 5.77 C 16-90 None
5oy7 X-ray 5.77 G 14-90 None
5oy7 X-ray 5.77 K 16-90 None
5oy7 X-ray 5.77 S 16-90 None
5oy7 X-ray 5.77 W 14-90 None
5oy7 X-ray 5.77 O 14-90 None
5oy7 X-ray 5.77 a 16-90 None
5dnm X-ray 2.81 G 14-90 None
5dnm X-ray 2.81 C 14-90 None
5dnn X-ray 2.8 G 14-90 None
5dnn X-ray 2.8 C 14-90 None
6ltj X-ray 3.7 G 15-90 None
6ltj X-ray 3.7 C 16-90 None
5nl0 X-ray 5.4 M 14-90 None
5nl0 X-ray 5.4 G 16-90 None
5nl0 X-ray 5.4 C 14-90 None
6px3 X-ray 4.1 G 17-90  H-Bb S-Bb L-Bb 
6px3 X-ray 4.1 C -33-90  H-Bb S-Bb 
6ftx X-ray 4.5 C 16-90 None
6ftx X-ray 4.5 G 14-90 None
5e5a X-ray 2.81 G 14-90  H-Bb S-Bb L-Bb 
5e5a X-ray 2.81 C 14-90  H-Bb S-Bb L-Bb 
4ys3 X-ray 3 G 1014-1090  H-Bb S-Bb L-Bb 
4ys3 X-ray 3 C 814-890  H-Bb S-Bb L-Bb 
5mlu X-ray 2.8 G 14-90 None
5mlu X-ray 2.8 C 16-90 None
6nog X-ray 3.9 G 14-90  H-Bb S-Bb L-Bb 
6nog X-ray 3.9 C 14-90  H-Bb S-Bb L-Bb 
5hq2 X-ray 4.5 G 15-90 None
4xzq X-ray 2.4 G 1014-1090  H-Bb S-Bb L-Bb 
4xzq X-ray 2.4 C 814-890  H-Bb S-Bb L-Bb 
4ld9 X-ray 3.31 G 18-90 None
4ld9 X-ray 3.31 C 20-90 None
6ryu X-ray 4 C 16-90 None
6ryu X-ray 4 G 14-90 None
4r8p X-ray 3.28 C 16-90 None
4xuj X-ray 3.18 G 14-90 None
4xuj X-ray 3.18 C 14-90 None
5cp6 X-ray 2.6 G 14-90 None
5cp6 X-ray 2.6 C 14-90 None
5omx X-ray 2.32 C 14-90 None
5omx X-ray 2.32 G 16-90 None
5ong X-ray 2.8 G 14-90 None
5ong X-ray 2.8 C 15-90 None
4z66 X-ray 2.5 G 1014-1090  H-Bb S-Bb L-Bb 
4z66 X-ray 2.5 C 814-890  H-Bb S-Bb L-Bb 
6x0n X-ray 10 c 10-84 None
5xf6 X-ray 2.63 C 14-90 None
5xf6 X-ray 2.63 G 14-90 None
4zux X-ray 3.82 Q 14-90 None
4zux X-ray 3.82 M 16-90 None
4zux X-ray 3.82 G 6-82 None
4zux X-ray 3.82 C 16-90 None
6r25 X-ray 4.61 C 17-90 None
6i84 X-ray 4.4 Q 16-90  L-Bb 
6i84 X-ray 4.4 V 14-90 None
5oxv X-ray 6.72 C 16-90 None
5oxv X-ray 6.72 M 16-90 None
5oxv X-ray 6.72 G 14-90 None
5oxv X-ray 6.72 Q 14-90 None
6nn6 X-ray 3.9 G 14-90 None
6nn6 X-ray 3.9 C 15-90 None
6ven X-ray 3.37 C 15-90  H-Bb S-Bb L-Bb 
6r1u X-ray 4.36 C 16-90 None
6t9l X-ray 3.6 G 14-90 None
6t9l X-ray 3.6 C 16-90 None
6vyp X-ray 4.99 G 14-90 None
6vyp X-ray 4.99 C 16-90 None
6vyp X-ray 4.99 g 14-89 None
6vyp X-ray 4.99 c 16-90 None
6kw5 X-ray 10.13 T 15-90  H-Bb 
6tda X-ray 15 G 15-90  H-Bb S-Bb L-Bb 
6tda X-ray 15 C 15-90  H-Bb S-Bb L-Bb 
6px1 X-ray 3.3 G 17-90  H-Bb S-Bb L-Bb 
6px1 X-ray 3.3 C 17-90  H-Bb S-Bb L-Bb 
6om3 X-ray 3.3 C 15-90  H-Bb S-Bb L-Bb 
6tem X-ray 3.9 G 14-90 None
6tem X-ray 3.9 C 14-90 None
6kiw X-ray 4 G 14-90  H-Bb S-Bb L-Bb 
6nzo X-ray 3.8 G 17-90  H-Bb S-Bb L-Bb 
6nzo X-ray 3.8 C 17-90  H-Bb S-Bb 
6wz9 X-ray 2.8 C 16-90 None


© NPIDB team 2003 - 2021

text