Pfam domain
Pfam family: Histone (PF00125.26)
Uniprot AC: P06899
RecName: Histone H2B type 1-J
Begin-End: 33-102
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj S-Bb L-Bb L-Mn 

Sequence:
SRKESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITS
REIQTAVRLL
Structures of the domain P06899 33-102
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5x7x X-ray 2.18 H 34-101  H-Bb H-Mj S-Bb L-Bb 
5x7x X-ray 2.18 D 32-101  H-Bb H-Mj S-Bb L-Bb 
3w98 X-ray 3.42 D 30-101  H-Bb H-Mj L-Bb 
3w98 X-ray 3.42 H 33-101  H-Bb L-Bb 
3azl X-ray 2.7 H 32-101  H-Bb L-Bb 
3azl X-ray 2.7 D 31-101  H-Bb H-Mj S-Bb L-Bb 
6j4y X-ray 4.3 d 28-98 None
6j4y X-ray 4.3 h 31-98 None
5xf4 X-ray 2.87 H 28-98 None
5xf4 X-ray 2.87 D 28-98 None
5cpk X-ray 2.63 H 34-101  H-Bb H-Mj L-Bb 
5cpk X-ray 2.63 D 32-101  H-Bb H-Mj L-Bb 
5z23 X-ray 2.73 D 32-101  H-Bb H-Mj S-Bb L-Bb 
5z23 X-ray 2.73 H 33-101  H-Bb S-Bb L-Bb 
5av9 X-ray 2.2 H 31-101 None
5av9 X-ray 2.2 D 29-101 None
6a5r X-ray 8.7 h 3-82 None
6a5r X-ray 8.7 d 28-98 None
6r8y X-ray 4.3 H 30-102  H-Bb L-Bb 
6r8y X-ray 4.3 D 30-102  H-Bb L-Bb 
6hts X-ray 4.8 P 31-101 None
6hts X-ray 4.8 L 30-101 None
6j4z X-ray 4.1 h 3-80 None
6j4z X-ray 4.1 d 3-73 None
6t93 X-ray 3.49 H 32-102  H-Bb S-Bb L-Bb 
6t93 X-ray 3.49 D 32-102  H-Bb S-Bb L-Bb L-Mn 
6jr1 X-ray 2.4 H 33-102  H-Bb H-Mj S-Bb L-Bb L-Mn 
6jr1 X-ray 2.4 D 32-102  H-Bb H-Mj S-Bb L-Bb 
3wtp X-ray 2.67 H 32-101  H-Bb S-Bb L-Bb 
3wtp X-ray 2.67 D 30-101  H-Bb H-Mj S-Bb L-Bb 
6k1k X-ray 2.2 H 26-98 None
6k1k X-ray 2.2 D 26-98 None
3azg X-ray 2.4 H 32-101  H-Bb S-Bb L-Bb 
3azg X-ray 2.4 D 31-101  H-Bb H-Mj S-Bb L-Bb 
3waa X-ray 3.2 H 33-101  H-Bb S-Bb L-Bb 
3waa X-ray 3.2 D 31-101  H-Bb H-Mj S-Bb L-Bb 
6buz X-ray 3.92 H 32-102 None
6buz X-ray 3.92 D 32-102 None
6e0p X-ray 2.6 H 31-101  H-Bb H-Mj S-Bb L-Bb 
6e0p X-ray 2.6 D 30-101  H-Bb H-Mj S-Bb L-Bb 
3afa X-ray 2.5 H 33-101  H-Bb H-Mj S-Bb L-Bb 
3afa X-ray 2.5 D 30-101  H-Bb H-Mj S-Bb L-Bb 
3av1 X-ray 2.5 H 33-101  H-Bb H-Mj S-Bb L-Bb 
3av1 X-ray 2.5 D 32-101  H-Bb H-Mj S-Bb L-Bb 
3azi X-ray 2.7 H 32-101  H-Bb H-Mj L-Bb 
3azi X-ray 2.7 D 30-101  H-Bb H-Mj S-Bb L-Bb 
3av2 X-ray 2.8 H 33-101  H-Bb L-Bb 
3av2 X-ray 2.8 D 31-101  H-Bb H-Mj S-Bb L-Bb 
3azf X-ray 2.7 H 33-101  H-Bb L-Bb 
3azf X-ray 2.7 D 31-101  H-Bb H-Mj S-Bb L-Bb 
3aze X-ray 3 D 31-101  H-Bb H-Mj S-Bb L-Bb 
3aze X-ray 3 H 33-101  H-Bb H-Mj S-Bb L-Bb 
3azj X-ray 2.89 H 32-101  H-Bb L-Bb 
3azj X-ray 2.89 D 29-101  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azk X-ray 3.2 H 32-101  H-Bb S-Bb L-Bb 
3azk X-ray 3.2 D 30-101  H-Bb H-Mj S-Bb L-Bb 
3azm X-ray 2.89 H 33-101  H-Bb H-Mj S-Bb L-Bb 
3azm X-ray 2.89 D 30-101  H-Bb H-Mj L-Bb 
3ayw X-ray 2.9 D 30-101  H-Bb H-Mj S-Bb L-Bb 
3ayw X-ray 2.9 H 33-101  H-Bb L-Bb 
3azn X-ray 3 H 32-101  H-Bb S-Bb L-Bb 
3azn X-ray 3 D 30-101  H-Bb H-Mj S-Bb L-Bb 
3a6n X-ray 2.7 H 32-101  H-Bb S-Bb L-Bb 
3a6n X-ray 2.7 D 31-101  H-Bb H-Mj S-Bb L-Bb 
3an2 X-ray 3.6 H 35-101 None
3an2 X-ray 3.6 D 35-101 None
3azh X-ray 3.49 D 30-101  H-Bb H-Mj S-Bb L-Bb L-Mn 
3azh X-ray 3.49 H 33-101  H-Bb L-Bb 
6kvd X-ray 2.21 H 32-101  H-Bb S-Bb L-Bb 
6kvd X-ray 2.21 D 32-101  H-Bb H-Mj S-Bb L-Bb 
5cpi X-ray 2.9 D 32-101  H-Bb S-Bb L-Bb L-Mn 
5cpi X-ray 2.9 H 33-101  H-Bb L-Bb 
4z5t X-ray 2.8 H 33-101  H-Bb H-Mj L-Bb 
4z5t X-ray 2.8 D 33-101  H-Bb H-Mj S-Bb L-Bb 
6j4w X-ray 7.9 h 29-98 None
6j4w X-ray 7.9 d 28-98 None
4ym6 X-ray 3.51 H 33-101  H-Bb L-Bb 
4ym6 X-ray 3.51 D 30-101  H-Bb H-Mj S-Bb L-Bb 
3wa9 X-ray 3.07 D 32-101  H-Bb H-Mj S-Bb L-Bb 
3wa9 X-ray 3.07 H 32-101  H-Bb H-Mj S-Bb L-Bb L-Mn 
3w96 X-ray 3 H 33-101  H-Bb H-Mj 
3w96 X-ray 3 D 30-101  H-Bb H-Mj 
6hkt X-ray 9.7 3 27-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 R 27-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 x 27-98  H-Bb H-Mj S-Bb L-Bb 
6hkt X-ray 9.7 1 27-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 X 27-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 r 27-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 n 27-98  H-Bb H-Mj S-Bb L-Bb 
6hkt X-ray 9.7 N 27-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 h 27-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 d 27-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 H 27-98  H-Bb S-Bb L-Bb 
6hkt X-ray 9.7 D 27-98  H-Bb S-Bb L-Bb 
3w97 X-ray 3.2 H 33-101  H-Bb L-Bb 
3w97 X-ray 3.2 D 32-101  H-Bb H-Mj S-Bb L-Bb 
5xf3 X-ray 2.6 H 28-98 None
5xf3 X-ray 2.6 D 28-98 None
5b0y X-ray 2.56 H 33-101  H-Bb H-Mj S-Bb L-Bb 
5b0y X-ray 2.56 D 32-101  H-Bb H-Mj S-Bb L-Bb 
5av6 X-ray 2.2 H 31-101 None
5av6 X-ray 2.2 D 29-101 None
6jr0 X-ray 2.5 H 32-101  H-Bb H-Mj S-Bb L-Bb 
6jr0 X-ray 2.5 D 33-101  H-Bb H-Mj S-Bb L-Bb L-Mn 
6k1j X-ray 2.85 H 28-98 None
6k1j X-ray 2.85 D 26-98 None
5gse X-ray 3.14 N 32-101  H-Bb S-Bb L-Bb L-Mn 
5gse X-ray 3.14 H 34-101  H-Bb S-Bb L-Bb 
5gse X-ray 3.14 D 32-101  H-Bb L-Bb 
5gtc X-ray 2.7 H 33-101  H-Bb H-Mj S-Bb L-Bb 
5gtc X-ray 2.7 D 32-101  H-Bb H-Mj L-Bb L-Mn 
6ipu X-ray 1.99 H 28-98 None
6ipu X-ray 1.99 D 28-98 None
5b33 X-ray 2.93 H 33-101  H-Bb S-Bb L-Bb 
5b33 X-ray 2.93 D 33-101  H-Bb H-Mj S-Bb L-Bb 
6r94 X-ray 3.5 D 27-99  H-Bb S-Bb L-Bb 
5gxq X-ray 2.85 H 33-101  H-Bb S-Bb L-Bb 
5gxq X-ray 2.85 D 30-101  H-Bb H-Mj S-Bb L-Bb 
5av8 X-ray 2.2 D 29-101 None
5av8 X-ray 2.2 H 31-101 None
7k60 X-ray 3.12 D 30-101  H-Bb S-Bb L-Bb 
7k60 X-ray 3.12 H 30-101  H-Bb S-Bb L-Bb 
5avb X-ray 2.4 D 29-101 None
5avb X-ray 2.4 H 31-101 None
5b2i X-ray 3 D 26-98 None
5b2i X-ray 3 H 28-98 None
5b32 X-ray 2.35 H 34-101  H-Bb H-Mj S-Bb L-Bb 
5b32 X-ray 2.35 D 32-101  H-Bb H-Mj S-Bb L-Bb 
5y0d X-ray 1.99 H 33-101  H-Bb H-Mj S-Bb L-Bb 
5y0d X-ray 1.99 D 32-101  H-Bb H-Mj S-Bb L-Bb 
5avc X-ray 2.4 D 29-101 None
5avc X-ray 2.4 H 31-101 None
5xf5 X-ray 2.82 D 28-98 None
5xf5 X-ray 2.82 H 28-98 None
6e0c X-ray 2.63 H 31-101  H-Bb S-Bb L-Bb 
6e0c X-ray 2.63 D 30-101  H-Bb S-Bb L-Bb 
5b24 X-ray 3.6 H 33-101  H-Bb S-Bb L-Bb 
5b24 X-ray 3.6 D 32-101  H-Bb H-Mj S-Bb L-Bb 
5b31 X-ray 2.2 H 34-101  H-Bb H-Mj S-Bb L-Bb 
5b31 X-ray 2.2 D 32-101  H-Bb H-Mj S-Bb L-Bb 
6m3v X-ray 4.6 R 30-101  H-Bb S-Bb L-Bb 
6m3v X-ray 4.6 N 31-101  H-Bb S-Bb L-Bb 
6m3v X-ray 4.6 H 32-101  H-Bb S-Bb L-Bb 
6m3v X-ray 4.6 D 31-101  H-Bb S-Bb L-Bb L-Mn 
5jrg X-ray 2.5 H 29-101  H-Bb H-Mj S-Bb L-Bb 
3w99 X-ray 3 H 33-101  H-Bb L-Bb 
3w99 X-ray 3 D 30-101  H-Bb H-Mj S-Bb L-Bb 
5av5 X-ray 2.4 H 31-101 None
5av5 X-ray 2.4 D 29-101 None
6yov X-ray 3.42 H 34-102  L-Bb 
6yov X-ray 3.42 D 33-102  H-Bb S-Bb L-Bb 
5y0c X-ray 2.09 H 33-101  H-Bb H-Mj S-Bb L-Bb 
5y0c X-ray 2.09 D 32-101  H-Bb H-Mj S-Bb L-Bb 
6kxv X-ray 3.63 H 34-101  H-Bb S-Bb L-Bb 
6kxv X-ray 3.63 D 30-101  H-Bb S-Bb L-Bb 
6l49 X-ray 18.9 N 28-98 None
6l49 X-ray 18.9 R 29-98 None
6l49 X-ray 18.9 V 28-98 None
6l49 X-ray 18.9 H 35-101 None
6l49 X-ray 18.9 D 35-101 None
6l49 X-ray 18.9 Z 29-98 None
5z30 X-ray 2.45 H 33-101  H-Bb H-Mj S-Bb L-Bb L-Mn 
5z30 X-ray 2.45 D 32-101  H-Bb H-Mj S-Bb L-Bb L-Mn 
5zbx X-ray 2.58 D 32-101  H-Bb H-Mj S-Bb L-Bb 
5zbx X-ray 2.58 H 33-101  H-Bb S-Bb L-Bb 
5b2j X-ray 2.6 H 28-98 None
5b2j X-ray 2.6 D 26-98 None
6inq X-ray 6.9 h 3-80 None
6inq X-ray 6.9 d 28-98 None
6a5o X-ray 9.9 h 29-98 None
6a5o X-ray 9.9 d 28-98 None
6a5u X-ray 7.6 h 31-98 None
6a5u X-ray 7.6 d 28-98 None
6iq4 X-ray 2.25 D 28-98 None
6iq4 X-ray 2.25 H 28-98 None
6a5p X-ray 7 h 29-98 None
6a5p X-ray 7 d 28-98 None
6j4x X-ray 4.3 h 3-80 None
6j4x X-ray 4.3 d 28-98 None
6j51 X-ray 4.2 d 28-98 None
6j51 X-ray 4.2 h 3-80 None
5cpj X-ray 3.15 H 33-101  H-Bb 
5cpj X-ray 3.15 D 32-101 None
6a5l X-ray 5.6 h 31-98 None
6a5l X-ray 5.6 d 3-93 None
6k1i X-ray 2.75 D 26-98 None
6k1i X-ray 2.75 H 26-98 None
7ccr X-ray 4.9 H 32-101 None
7ccr X-ray 4.9 D 32-101 None
7ccr X-ray 4.9 S 32-101 None
7ccr X-ray 4.9 O 32-101 None
4ym5 X-ray 4.01 H 29-101  H-Bb H-Mj S-Bb L-Bb L-Mn 
4ym5 X-ray 4.01 D 32-101  H-Bb H-Mj S-Bb L-Bb 
5b0z X-ray 1.99 H 34-101  H-Bb S-Bb L-Bb 
5b0z X-ray 1.99 D 31-101  H-Bb H-Mj S-Bb L-Bb 
6j50 X-ray 4.7 h 31-98 None
6j50 X-ray 4.7 d 28-98 None
6r8z X-ray 3.9 H 30-102  H-Bb H-Mj S-Bb L-Bb 
6r8z X-ray 3.9 D 30-102  H-Bb S-Bb L-Bb 
6l4a X-ray 12.3 Z 29-98 None
6l4a X-ray 12.3 V 28-98 None
6l4a X-ray 12.3 R 29-98 None
6l4a X-ray 12.3 N 28-98 None
6l4a X-ray 12.3 H 29-98 None
6l4a X-ray 12.3 D 28-98 None
6jxd X-ray 2.25 H 26-98 None
6jxd X-ray 2.25 D 26-98 None
6r90 X-ray 4.5 H 34-102  H-Bb H-Mj S-Bb L-Bb 
6r90 X-ray 4.5 D 33-102  H-Bb H-Mj S-Bb L-Bb 
6ir9 X-ray 3.8 h 31-98 None
6ir9 X-ray 3.8 d 28-98 None
5b40 X-ray 3.33 H 34-101  H-Bb 
5b40 X-ray 3.33 D 32-101  H-Bb H-Mj 
6a5t X-ray 6.7 d 3-93 None
6a5t X-ray 6.7 h 31-98 None
6o1d X-ray 3.4 H 31-101  H-Bb H-Mj S-Bb L-Bb 
6o1d X-ray 3.4 D 31-101  H-Bb H-Mj S-Bb L-Bb 
6r93 X-ray 4 D 30-102  H-Bb H-Mj S-Bb L-Bb L-Mn 
6r93 X-ray 4 H 30-102  H-Bb H-Mj S-Bb L-Bb L-Mn 
5ay8 X-ray 2.8 H 33-101  H-Bb H-Mj S-Bb L-Bb 
5ay8 X-ray 2.8 D 33-101  H-Bb H-Mj S-Bb L-Bb 
6t90 X-ray 3.05 H 33-102  H-Bb S-Bb L-Bb 
6t90 X-ray 3.05 D 33-102  H-Bb S-Bb L-Bb 
6r92 X-ray 4.8 H 30-102  H-Bb S-Bb L-Bb 
6r92 X-ray 4.8 D 32-102  S-Bb L-Bb 
6r91 X-ray 4.1 H 30-102  H-Bb H-Mj S-Bb L-Bb L-Mn 
6r91 X-ray 4.1 D 30-102  H-Bb S-Bb L-Bb 
7ccq X-ray 3.8 H 32-101 None
7ccq X-ray 3.8 D 32-101 None
6la8 X-ray 3.4 R 30-101  H-Bb S-Bb L-Bb 
6la8 X-ray 3.4 N 30-101  H-Bb S-Bb L-Bb 
6la8 X-ray 3.4 H 30-101  H-Bb S-Bb L-Bb 
6la8 X-ray 3.4 D 30-101  H-Bb S-Bb L-Bb 
6la9 X-ray 3.7 H 31-101  H-Bb S-Bb L-Bb 
6la9 X-ray 3.7 D 31-101  H-Bb S-Bb L-Bb 
6la9 X-ray 3.7 N 31-101  H-Bb S-Bb L-Bb 
6la9 X-ray 3.7 R 31-101  H-Bb S-Bb L-Bb 
7k63 X-ray 3.03 D 30-101  H-Bb S-Bb L-Bb L-Mn 
7k63 X-ray 3.03 H 30-101  H-Bb S-Bb L-Bb 
6jou X-ray 2.17 D 32-101  H-Bb H-Mj S-Bb L-Bb 
6jou X-ray 2.17 H 32-101  H-Bb H-Mj S-Bb L-Bb L-Mn 
6usj X-ray 10.5 D 32-101 None
6usj X-ray 10.5 H 33-101 None
6usj X-ray 10.5 N 32-101 None
6usj X-ray 10.5 R 33-101 None
7k5x X-ray 2.93 D 30-101  H-Bb S-Bb L-Bb 
7k5x X-ray 2.93 H 30-101  H-Bb H-Mj S-Bb L-Bb 
6m44 X-ray 3.81 D 31-101  H-Bb S-Bb L-Bb L-Mn 
6m44 X-ray 3.81 H 32-101  H-Bb S-Bb L-Bb 
6m44 X-ray 3.81 N 31-101  S-Bb L-Bb 
6m44 X-ray 3.81 R 30-101  S-Bb L-Bb L-Mn 
7k61 X-ray 2.85 D 30-101  H-Bb S-Bb L-Bb 
7k61 X-ray 2.85 H 30-101  H-Bb S-Bb L-Bb L-Mn 
6v2k X-ray 2.6 D 32-101  H-Bb H-Mj S-Bb L-Bb 
6v2k X-ray 2.6 H 33-101  H-Bb H-Mj S-Bb L-Bb 
7c0m X-ray 3.9 D 31-101  H-Bb S-Bb L-Bb L-Mn 
7c0m X-ray 3.9 H 32-101  H-Bb S-Bb L-Bb L-Mn 
7c0m X-ray 3.9 d 31-101  H-Bb S-Bb L-Bb L-Mn 
7c0m X-ray 3.9 h 32-101  H-Bb S-Bb L-Bb L-Mn 
7k5y X-ray 2.76 D 30-101  H-Bb S-Bb L-Bb L-Mn 
7k5y X-ray 2.76 H 30-101  H-Bb S-Bb L-Bb 


© NPIDB team 2003 - 2021

text