Pfam domain
Pfam family: HTH_Tnp_Tc5 (PF03221.18)
Uniprot AC: P07199
RecName: Major centromere autoantigen B
Begin-End: 74-129
Organism: Homo sapiens
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
YDKLEGLLIAWFQQIRAAGLPVKGIILKEKALRIAEELGMDDFTASNGWLDRFRRR
Structures of the domain P07199 74-129
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1hlv X-ray 2.5 A 74-131  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text