Pfam domain
Pfam family: Zn_clus (PF00172.20)
Uniprot AC: P07272
RecName: Pyrimidine pathway regulatory protein 1
Begin-End: 32-71
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
TACKRCRLKKIKCDQEFPSCKRCAKLEVPCVSLDPATGKD
Structures of the domain P07272 32-71
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1pyi X-ray 3.2 B 32-71  H-Bb H-Mj L-Bb L-Mj 
1pyi X-ray 3.2 A 32-71  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text