Pfam domain
Pfam family: TFIIS_M (PF07500.16)
Uniprot AC: P07273
RecName: Transcription elongation factor S-II
Begin-End: 144-256
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
YHHKLRDQVLKALYDVLAKESEHPPQSILHTAKAIESEMNKVNNCDTNEAAYKARYRIIY
SNVISKNNPDLKHKIANGDITPEFLATCDAKDLAPAPLKQKIEEIAKQNLYNA
Structures of the domain P07273 144-256
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1y1y X-ray 4 S 144-256 None
5fmf X-ray 6 2 144-256 None
3gtm X-ray 3.8 S 147-256 None
3po3 X-ray 3.3 S 146-256 None


© NPIDB team 2003 - 2021

text