Pfam domain
Pfam family: XPG_I (PF00867.20)
Uniprot AC: P07276
RecName: DNA repair protein RAD2
Begin-End: 783-864
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb S-Bb L-Bb 

Sequence:
GIPYITAPMEAEAQCAELLQLNLVDGIITDDSDVFLFGGTKIYKNMFHEKNYVEFYDAES
ILKLLGLDRKNMIELAQLLGSD
Structures of the domain P07276 783-864
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
4q0z X-ray 2.4 F 783-864 None
4q0z X-ray 2.4 E 783-864 None
4q0z X-ray 2.4 B 783-864 None
4q0z X-ray 2.4 A 783-864 None
4q0r X-ray 2.75 B 783-864 None
4q0r X-ray 2.75 A 783-864 None
4q10 X-ray 2.7 B 783-864  L-Bb 
4q10 X-ray 2.7 A 783-864  H-Bb S-Bb 
4q0w X-ray 2.1 B 783-864 None
4q0w X-ray 2.1 A 783-864 None


© NPIDB team 2003 - 2021

text