Pfam domain
Pfam family: KorB (PF08535.12)
Uniprot AC: P07674
RecName: Transcriptional repressor protein KorB
Begin-End: 166-251
Organism: Escherichia coli
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
AKGKKKGDIAKEIGKSPAFITQHVTLLDLPEKIADAFNTGRVRDVTVVNELVTAFKKRPE
EVEAWLDDDTQEITRGTVKLLREFLD
Structures of the domain P07674 166-251
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1r71 X-ray 2.2 C 166-251  H-Bb H-Mj L-Bb L-Mj 
1r71 X-ray 2.2 D 166-252  H-Bb H-Mj L-Bb 
1r71 X-ray 2.2 A 166-252  H-Bb H-Mj L-Bb L-Mj 
1r71 X-ray 2.2 B 166-252  H-Bb H-Mj L-Bb 


© NPIDB team 2003 - 2021

text