Pfam domain
Pfam family: PDDEXK_1 (PF12705.9)
Uniprot AC: P08394
RecName: RecBCD enzyme subunit RecB
Begin-End: 934-1174
Organism: Escherichia coli
Interaction Mode:   

Sequence:
VVEEPTLTPHQFPRGASPGTFLHSLFEDLDFTQPVDPNWVREKLELGGFESQWEPVLTEW
ITAVLQAPLNETGVSLSQLSARNKQVEMEFYLPISEPLIASQLDTLIRQFDPLSAGCPPL
EFMQVRGMLKGFIDLVFRHEGRYYLLDYKSNWLGEDSSAYTQQAMAAAMQAHRYDLQYQL
YTLALHRYLRHRIADYDYEHHFGGVIYLFLRGVDKEHPQQGIYTTRPNAGLIALMDEMFA
G
Structures of the domain P08394 934-1174
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
1w36 X-ray 3.1 B 934-1169 None
1w36 X-ray 3.1 E 934-1169 None
3k70 X-ray 3.59 B 934-1169 None
3k70 X-ray 3.59 E 934-1169 None


© NPIDB team 2003 - 2021

text