Pfam domain
Pfam family: Zn_clus (PF00172.20)
Uniprot AC: P08638
RecName: Regulatory protein LEU3
Begin-End: 35-77
Organism: Saccharomyces cerevisiae
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj 

Sequence:
FACVECRQQKSKCDAHERAPEPCTKCAKKNVPCILKRDFRRTY
Structures of the domain P08638 35-77
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2ere X-ray 3 B 35-77  H-Bb H-Mj L-Bb L-Mj 
2ere X-ray 3 A 35-77  H-Bb H-Mj L-Bb L-Mj 
2erg X-ray 3.15 B 35-77  H-Bb H-Mj L-Bb L-Mj 
2erg X-ray 3.15 A 35-77  H-Bb H-Mj L-Bb L-Mj 
2er8 X-ray 2.85 B 35-77  H-Bb H-Mj L-Bb L-Mj 
2er8 X-ray 2.85 A 35-77  H-Bb H-Mj L-Bb L-Mj 
2er8 X-ray 2.85 D 35-77  H-Bb H-Mj L-Bb L-Mj 
2er8 X-ray 2.85 C 35-77  H-Bb H-Mj L-Bb L-Mj 


© NPIDB team 2003 - 2021

text