Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: P09077
RecName: Homeotic protein Sex combs reduced
Begin-End: 327-381
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj L-Bb L-Mn 

Sequence:
QRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALCLTERQIKIWFQNRRMKWKK
Structures of the domain P09077 327-381
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
2r5z X-ray 2.6 A 90-158  H-Bb H-Mj L-Bb L-Mn 
2r5y X-ray 2.6 A 87-158  H-Bb H-Mj L-Bb L-Mn 


© NPIDB team 2003 - 2021

text