Pfam domain
Pfam family: Homeodomain (PF00046.31)
Uniprot AC: P09087
RecName: Homeobox protein abdominal-B
Begin-End: 389-444
Organism: Drosophila melanogaster
Interaction Mode:  H-Bb H-Mj L-Bb L-Mj L-Mn 

Sequence:
KKRKPYSKFQTLELEKEFLFNAYVSKQKRWELARNLQLTERQVKIWFQNRRMKNKK
Structures of the domain P09087 389-444
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
5zjq X-ray 2.44 A 14-76  H-Bb H-Mj L-Bb L-Mn 
5zjr X-ray 3.03 A 20-76  H-Bb H-Mj L-Bb L-Mn 
5zjs X-ray 2.9 A 13-76  H-Bb H-Mj L-Bb L-Mn 
5zjt X-ray 2.4 A 15-76  H-Bb H-Mj L-Bb L-Mj L-Mn 
5zjt X-ray 2.4 E 21-76  H-Bb H-Mj L-Bb L-Mj L-Mn 


© NPIDB team 2003 - 2021

text