Pfam domain
Pfam family: Cdc6_C (PF09079.13)
Uniprot AC: P09119
RecName: Cell division control protein 6
Begin-End: 418-498
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
LCTIIQSLKLNSDATIDESFDHYIKAITKTDTLAPLQRNEFLEICTILETCGLVSIKKTK
CKGKTKRFVDKIDVDLDMREF
Structures of the domain P09119 418-498
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wgg X-ray 8.1 9 418-485 None
6wgi X-ray 10 9 418-485  S-Bb 
5v8f X-ray 3.9 9 418-485 None
6wgc X-ray 4.3 9 418-485 None


© NPIDB team 2003 - 2021

text