Pfam domain
Pfam family: AAA_22 (PF13401.8)
Uniprot AC: P09119
RecName: Cell division control protein 6
Begin-End: 97-267
Organism: Saccharomyces cerevisiae
Interaction Mode:   

Sequence:
SEHRSDSLYITGPPGTGKTAQLDMIIRQKFQSLPLSLSTPRSKDVLRHTNPNLQNLSWFE
LPDGRLESVAVTSINCISLGEPSSIFQKIFDSFQDLNGPTLQIKNMQHLQKFLEPYHKKT
TFVVVLDEMDRLLHANTSETQSVRTILELFLLAKLPTVSFVLIGMANSLDM
Structures of the domain P09119 97-267
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6wgg X-ray 8.1 9 102-263 None
6wgi X-ray 10 9 102-263 None
5v8f X-ray 3.9 9 102-263  H-Bb L-Bb 
6wgc X-ray 4.3 9 102-263 None


© NPIDB team 2003 - 2021

text