Pfam domain
Pfam family: HMG_box (PF00505.21)
Uniprot AC: P09429
RecName: High mobility group protein B1
Begin-End: 101-155
Organism: Homo sapiens
Interaction Mode:   

Sequence:
AFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEKY
Structures of the domain P09429 101-155
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6oem X-ray 3.6 H 101-155  H-Bb H-Mn 
6oeo X-ray 3.69 N 101-155  H-Bb H-Mn 
6oen X-ray 4.3 H 101-155  H-Bb H-Mn 


© NPIDB team 2003 - 2021

text