Pfam domain
Pfam family: HMG_box_2 (PF09011.12)
Uniprot AC: P09429
RecName: High mobility group protein B1
Begin-End: 15-50
Organism: Homo sapiens
Interaction Mode:   

Sequence:
SYAFFVQTCREEHKKKHPDASVNFSEFSKKCSERWK
Structures of the domain P09429 15-50
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cik X-ray 3.15 N 19-48  H-Bb H-Mj H-Mn 
6cg0 X-ray 3.17 N 15-96  H-Bb L-Bb L-Mj L-Mn 
6cim X-ray 3.6 N 19-48  H-Bb H-Mn 


© NPIDB team 2003 - 2021

text