Pfam domain
Pfam family: HMG_box (PF00505.21)
Uniprot AC: P09429
RecName: High mobility group protein B1
Begin-End: 95-158
Organism: Homo sapiens
Interaction Mode:   

Sequence:
PKRPPSAFFLFCSEYRPKIKGEHPGLSIGDVAKKLGEMWNNTAADDKQPYEKKAAKLKEK
YEKD
Structures of the domain P09429 95-158
Export table
PDB ID Exp. data Chain Begin-End Interaction mode
6cik X-ray 3.15 N 47-159  H-Bb H-Mj H-Mn 
6cil X-ray 4.15 N 99-159  H-Mn L-Mn 
6cim X-ray 3.6 N 47-159  H-Bb H-Mj H-Mn 
6cij X-ray 3.9 N 95-158  H-Bb H-Mj H-Mn 


© NPIDB team 2003 - 2021

text